Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385392

    Description: epitope description:TPTPVNPSTAPAPAPTPTFACCQTPVNGNSPWAPTAPLPGDM antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organis...

    Publication: 9854087;

  2. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385397

    Description: epitope description:FLTEEPFQRGDPFDKNYVGNSGKSRGGG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

    Publication: 9854087;

  3. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385400

    Description: epitope description:GGSLSSLANAGGLHDDG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

    Publication: 9854087;

  4. Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

    ID: 1386143

    Description: epitope description:QVATISAN antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 17606364;

  5. Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

    ID: 1386145

    Description: epitope description:DELDVVEGMQFDRGYLS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 17606364;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston