Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772280

    Description: epitope description:TGVDVSMNTHLKAVKMTLKN antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  2. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772281

    Description: epitope description:IRGNRIRYFILPDSLPLDTI antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  3. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772284

    Description: epitope description:PLDTIRVDVEPKVKSKKREA antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  4. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772291

    Description: epitope description:VAGRGRGRGRGRGRGRGRGRGGPRR antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  5. Characterization of molecular forms of probrain natriuretic peptide in human plasma.

    ID: 1772306

    Description: epitope description:NHLQGK antigen name:Natriuretic peptides B host organism:Oryctolagus cuniculus Japanese white

    Publication: 12867297;

  6. Antibodies raised against the second extracellular loop of the human muscarinic M3 receptor mimic functional autoantibodies in Sjögren's syndrome...

    ID: 1772322

    Description: epitope description:KRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030576;

  7. Antibodies raised against the second extracellular loop of the human muscarinic M3 receptor mimic functional autoantibodies in Sjögren's syndrome...

    ID: 1772330

    Description: epitope description:KRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030576;

  8. Autoreactive antibodies are present in sheep with Johne's disease and cross-react with Mycobacterium avium subsp. paratuberculosis antigens.

    ID: 1772339

    Description: epitope description:KSLSRHDHIHHH host organism:Ovis aries

    Publication: 17544799;

  9. Conserved beta-tubulin binding domain for the microtubule-associated motors underlying sperm motility and fast axonal transport.

    ID: 1772359

    Description: epitope description:GEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEF antigen name:Tubulin beta chain host organism:Oryctolagus cuniculus

    Publication: 1723030;

  10. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772363

    Description: epitope description:QRHLSSEPLSRKKL antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  11. Goodpasture's epitope in development of experimental autoimmune glomerulonephritis in rats.

    ID: 1772420

    Description: epitope description:SLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 8821814;

  12. Goodpasture's epitope in development of experimental autoimmune glomerulonephritis in rats.

    ID: 1772422

    Description: epitope description:SLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 8821814;

  13. HLA class II influences the immune response and antibody diversification to Ro60/Sjögren's syndrome-A: heightened antibody responses and epitope ...

    ID: 1772461

    Description: epitope description:GMALALAVTKYKQRNGWSHKDLLRL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus HLA-DQ6 Tg

    Publication: 12023392;

  14. HLA class II influences the immune response and antibody diversification to Ro60/Sjögren's syndrome-A: heightened antibody responses and epitope ...

    ID: 1772464

    Description: epitope description:ELEVIHLIEEHRLVREHLLTNHLKS antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus HLA-DQ6 Tg

    Publication: 12023392;

  15. HLA class II influences the immune response and antibody diversification to Ro60/Sjögren's syndrome-A: heightened antibody responses and epitope ...

    ID: 1772480

    Description: epitope description:VFTDNETFAGGVHPAIALRE antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus HLA-DR2 Tg

    Publication: 12023392;

  16. Receptor-associated protein and members of the low density lipoprotein receptor family share a common epitope. An extended model for the development o...

    ID: 1772509

    Description: epitope description:PVRLAEL antigen name:Alpha-2-macroglobulin receptor-associated protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8910522;

  17. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772515

    Description: epitope description:PQIVPEPM antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Oryctolagus cuniculus

    Publication: 7878031;

  18. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772519

    Description: epitope description:EVFISAPR antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 7878031;

  19. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772522

    Description: epitope description:PQIVPEPM antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 7878031;

  20. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772530

    Description: epitope description:PVFIPAPR antigen name:Protein BOLF1 host organism:Homo sapiens

    Publication: 7878031;

  21. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772561

    Description: epitope description:DIFIVSPR antigen name:Mumps rubulavirus protein host organism:Homo sapiens

    Publication: 7878031;

  22. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772575

    Description: epitope description:DVYIRTPR antigen name:Putative BBLF3 protein host organism:Homo sapiens

    Publication: 7878031;

  23. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772586

    Description: epitope description:PQVLPTPM antigen name:Epstein-Barr nuclear antigen 4 host organism:Homo sapiens

    Publication: 7878031;

  24. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772618

    Description: epitope description:QRHLSSEPLSRKKL antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  25. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772620

    Description: epitope description:RWGNQPERLNA antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  26. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772653

    Description: epitope description:THHINNMKPSFTRENT antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  27. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772659

    Description: epitope description:PDIITGFSS antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  28. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772661

    Description: epitope description:PDIITGFSS antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  29. Structural characterization and optimization of antibody-selected phage library mimotopes of an antigen associated with autoimmune recurrent thrombosi...

    ID: 1772672

    Description: epitope description:AGPCILLARDRCPG host organism:Homo sapiens Caucasian antibody name:ACA 6501

    Publication: 9819200;

  30. Structural characterization and optimization of antibody-selected phage library mimotopes of an antigen associated with autoimmune recurrent thrombosi...

    ID: 1772673

    Description: epitope description:AGPCILLARDRCPG host organism:Homo sapiens Caucasian antibody name:ACA 6501

    Publication: 9819200;

  31. Structural characterization and optimization of antibody-selected phage library mimotopes of an antigen associated with autoimmune recurrent thrombosi...

    ID: 1772675

    Description: epitope description:AGPCLLLAPDRCPG host organism:Homo sapiens Caucasian antibody name:ACA 6501

    Publication: 9819200;

  32. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772688

    Description: epitope description:YRVNLKFLPNETTSN antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  33. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772719

    Description: epitope description:AAGVLHYEQENNHLY antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  34. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772723

    Description: epitope description:LHFNKRILKSKMSES antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  35. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772725

    Description: epitope description:DGFMDFEVYSHQTKP antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  36. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772726

    Description: epitope description:HQTKPALNLDTLQVR antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  37. Epitopes in the interacting regions of beta-dystroglycan (PPxY motif) and dystrophin (WW domain).

    ID: 1772776

    Description: epitope description:3057S, 3059Q, 3060G, 3061P, 3062W, 3064R, 3065A antigen name:Dystrophin (UniProt:P11532) host organism:Mus musculus BALB/c antibod...

    Publication: 11420143;

  38. Epitopes in the interacting regions of beta-dystroglycan (PPxY motif) and dystrophin (WW domain).

    ID: 1772778

    Description: epitope description:3057S, 3059Q, 3060G, 3061P, 3062W, 3064R, 3065A antigen name:Dystrophin (UniProt:P11532) host organism:Mus musculus BALB/c antibod...

    Publication: 11420143;

  39. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772780

    Description: epitope description:PEYPDDASVNGVRKRKQNLV antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  40. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772781

    Description: epitope description:NGVRKRKQNLVQAWQAKHQGAQY antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  41. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772784

    Description: epitope description:MTEVALRVVSRNPRGFY antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  42. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772786

    Description: epitope description:HSHVFSFGGYTLRGTSIFG antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  43. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772787

    Description: epitope description:HSHVFSFGGYTLRGTSIFG antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  44. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772790

    Description: epitope description:GLAPSKALDSKSYTSIL antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  45. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772795

    Description: epitope description:THGGEDVAVFARGPQAHLVHGV antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  46. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772796

    Description: epitope description:EYPDDASVNGVRK antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  47. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772803

    Description: epitope description:WQAKHQGAQYVWN antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  48. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772807

    Description: epitope description:VALRVVSRNPRGF antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  49. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772808

    Description: epitope description:HSHVFSFGGYTLR antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  50. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772812

    Description: epitope description:RGTSIFGLAPSKA antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston