Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487746

    Description: epitope description:HGISEMWYLTPK host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;

  2. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487748

    Description: epitope description:YLGLTPM host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;

  3. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487750

    Description: epitope description:NKVWPPS host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;

  4. Antigenic properties and population stability of a foot-and-mouth disease virus with an altered Arg-Gly-Asp receptor-recognition motif.

    ID: 1487773

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:4C4, 5A2

    Publication: 10466785;

  5. Molecular basis of pollen-related food allergy: identification of a second cross-reactive IgE epitope on Pru av 1, the major cherry (Prunus avium) all...

    ID: 1487779

    Description: epitope description:N29 antigen name:Pru av 1 host organism:Homo sapiens

    Publication: 15330760;

  6. Murine IgE and IgG responses to melittin and its analogs.

    ID: 1487824

    Description: epitope description:GIGAVLKVLTTGLPALISWIKR antigen name:Api m 4 host organism:Mus musculus BALB/c

    Publication: 1707915;

  7. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487841

    Description: epitope description:SANMPTN host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;

  8. Identification of the location of antigenic sites of swine vesicular disease virus with neutralization-resistant mutants.

    ID: 1487844

    Description: epitope description:D655, N656 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G07

    Publication: 8847515;

  9. Identification of the location of antigenic sites of swine vesicular disease virus with neutralization-resistant mutants.

    ID: 1487845

    Description: epitope description:E232 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3H02

    Publication: 8847515;

  10. Binding of monoclonal antibody 4B1 to homologs of the lactose permease of Escherichia coli.

    ID: 1487882

    Description: epitope description:F247, F250, G254 antigen name:Lactose permease host organism:Mus musculus BALB/c antibody name:4B1

    Publication: 9232651;

  11. Antigenic sites on foot-and-mouth disease virus type A10.

    ID: 1487891

    Description: epitope description:L146, L149 antigen name:Polyprotein host organism:Mus musculus antibody name:mAb1.11

    Publication: 2455819;

  12. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487892

    Description: epitope description:LGGKFLE antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c antibody name:GDH 9-2A2

    Publication: 10491083;

  13. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487897

    Description: epitope description:LEGAARQ antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c antibody name:GDH 8-1B6, GDH 9-5B1, GDH 9-6D6

    Publication: 10491083;

  14. Precise characterization of norovirus (Norwalk-like virus)-specific monoclonal antibodies with broad reactivity.

    ID: 1487918

    Description: epitope description:QQNIIDPWIMN antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:1B4, 1F6

    Publication: 12791850;

  15. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487922

    Description: epitope description:FLEGAAR antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c antibody name:GDH 8-3A4, GDH 83C5, GDH 8-6D1, GDH 9-...

    Publication: 10491083;

  16. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487923

    Description: epitope description:LEGAAR antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c antibody name:GDH 5-6A3, GDH 8-5D3, GDH 8-6A5, GDH 9-...

    Publication: 10491083;

  17. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487925

    Description: epitope description:IGILGGK antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c

    Publication: 10491083;

  18. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487949

    Description: epitope description:GILGGKF antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c

    Publication: 10491083;

  19. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487955

    Description: epitope description:GGKFLEG antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c

    Publication: 10491083;

  20. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487964

    Description: epitope description:EGAARQP antigen name:ATP synthase subunit c host organism:Oryctolagus cuniculus

    Publication: 10491083;

  21. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487966

    Description: epitope description:GAARQPD antigen name:ATP synthase subunit c host organism:Oryctolagus cuniculus

    Publication: 10491083;

  22. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487969

    Description: epitope description:AARQPDL antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c

    Publication: 10491083;

  23. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487971

    Description: epitope description:ARQPDLI antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c

    Publication: 10491083;

  24. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487974

    Description: epitope description:QPDLIPL antigen name:ATP synthase subunit c host organism:Oryctolagus cuniculus

    Publication: 10491083;

  25. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487976

    Description: epitope description:PDLIPLL antigen name:ATP synthase subunit c host organism:Oryctolagus cuniculus

    Publication: 10491083;

  26. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487979

    Description: epitope description:DLIPLLR antigen name:ATP synthase subunit c host organism:Mus musculus BALB/c

    Publication: 10491083;

  27. F0 complex of the Escherichia coli ATP synthase. Not all monomers of the subunit c oligomer are involved in F1 interaction.

    ID: 1487980

    Description: epitope description:LIPLLRT antigen name:ATP synthase subunit c host organism:Oryctolagus cuniculus

    Publication: 10491083;

  28. Mapping of the mAb73 epitope on Ad2 E1A proteins with random peptide libraries and deletion mutants.

    ID: 1488000

    Description: epitope description:ITTFSKRHLWTYKLN host organism:Mus musculus BALB/c antibody name:mAb73

    Publication: 7507452;

  29. Mapping of the mAb73 epitope on Ad2 E1A proteins with random peptide libraries and deletion mutants.

    ID: 1488002

    Description: epitope description:SVARHKLPTHTLRRI host organism:Mus musculus BALB/c antibody name:mAb73

    Publication: 7507452;

  30. Mapping of the mAb73 epitope on Ad2 E1A proteins with random peptide libraries and deletion mutants.

    ID: 1488005

    Description: epitope description:AHLRLPTRTSMPKVT host organism:Mus musculus BALB/c antibody name:mAb73

    Publication: 7507452;

  31. Mapping of the mAb73 epitope on Ad2 E1A proteins with random peptide libraries and deletion mutants.

    ID: 1488009

    Description: epitope description:AHIRHHKMPVTTSAT host organism:Mus musculus BALB/c antibody name:mAb73

    Publication: 7507452;

  32. Monoclonal antibodies, against O1 serotype foot-and-mouth disease virus, from a natural bovine host, recognize similar antigenic features to those def...

    ID: 1488025

    Description: epitope description:N770 antigen name:Polyprotein host organism:Bos taurus Friesian antibody name:MH5

    Publication: 9680132;

  33. Epitope mapping of anti-recA protein IgGs by region specified polymerase chain reaction mutagenesis.

    ID: 1488045

    Description: epitope description:TAKEIEKKVRELLLSNPNSTPDFS antigen name:Protein RecA host organism:Mus musculus BALB/c antibody name:ARM193

    Publication: 1372903;

  34. Identification of immunodominant neutralizing epitopes on the hemagglutinin protein of rinderpest virus.

    ID: 1488142

    Description: epitope description:DSGTRK antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:mAb 59

    Publication: 11799164;

  35. Identification of immunodominant neutralizing epitopes on the hemagglutinin protein of rinderpest virus.

    ID: 1488173

    Description: epitope description:REACR antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:mAb 39

    Publication: 11799164;

  36. Phage-displayed Bet mim 1, a mimotope of the major birch pollen allergen Bet v 1, induces B cell responses to the natural antigen using bystander T ce...

    ID: 1488213

    Description: epitope description:CFPYCYPSESA host organism:Mus musculus BALB/c

    Publication: 12569978;

  37. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1488238

    Description: epitope description:TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN antigen name:Potassium channel toxin alpha-KTx 2.1 host organism:Mus musculus BALB/c antib...

    Publication: 11750040;

  38. Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and de...

    ID: 1488268

    Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Mus musculus BALB/c antibody name:FdR-1a, FdR-1b, FdR-2b, C...

    Publication: 7687098;

  39. Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and de...

    ID: 1488270

    Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Mus musculus BALB/c antibody name:FdR-1a, C5/24.6

    Publication: 7687098;

  40. Binding of monoclonal antibody 4B1 to homologs of the lactose permease of Escherichia coli.

    ID: 1488306

    Description: epitope description:F247, F250, G254 antigen name:Lactose permease host organism:Mus musculus BALB/c antibody name:4B1

    Publication: 9232651;

  41. Isolation and structure-functional characterization of phage display library-derived mimotopes of noxiustoxin, a neurotoxin of the scorpion Centruroid...

    ID: 1488349

    Description: epitope description:HNNQRLMLYGMH host organism:Mus musculus BALB/c antibody name:BNTX18

    Publication: 11275260;

  42. Isolation and structure-functional characterization of phage display library-derived mimotopes of noxiustoxin, a neurotoxin of the scorpion Centruroid...

    ID: 1488355

    Description: epitope description:EALYGMS host organism:Mus musculus BALB/c antibody name:BNTX18

    Publication: 11275260;

  43. Epitopes on Cry j I and Cry j II for the human IgE antibodies cross-reactive between Cupressus sempervirens and Cryptomeria japonica pollen.

    ID: 1488395

    Description: epitope description:NAGVLTCSLSK antigen name:Cry j 1 host organism:Mus musculus BALB/c antibody name:027

    Publication: 7679186;

  44. Immunodominant sites of human T cell lymphotropic virus type 1 envelope protein for murine helper T cells.

    ID: 1488454

    Description: epitope description:LPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus B10.BR

    Publication: 2528586;

  45. Immunodominant sites of human T cell lymphotropic virus type 1 envelope protein for murine helper T cells.

    ID: 1488456

    Description: epitope description:FTQEVSRLNINLHFSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus B10.BR

    Publication: 2528586;

  46. Epitope determinants of a chimpanzee dengue virus type 4 (DENV-4)-neutralizing antibody and protection against DENV-4 challenge in mice and rhesus mon...

    ID: 1488475

    Description: epitope description:K174, P176 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:Fab 5H2

    Publication: 17881450;

  47. Characterization of IgE-binding epitopes on Candida albicans enolase.

    ID: 1488480

    Description: epitope description:QAANDSYAAGWGVMVSHRSGETEDTFIADLSVGLRSGQI antigen name:Enolase 1 host organism:Homo sapiens

    Publication: 7544233;

  48. Epitope determinants of a chimpanzee dengue virus type 4 (DENV-4)-neutralizing antibody and protection against DENV-4 challenge in mice and rhesus mon...

    ID: 1488482

    Description: epitope description:K174, P176 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 17881450;

  49. Identification of an IgE-binding determinant of the major allergen Myr p I from the venom of the Australian jumper ant Myrmecia pilosula.

    ID: 1488608

    Description: epitope description:KEAIPMAVEMAKSQ antigen name:Myr p 1 host organism:Homo sapiens

    Publication: 7508264;

  50. Subgroup specific protection of mice from respiratory syncytial virus infection with peptides encompassing the amino acid region 174-187 from the G gl...

    ID: 1488614

    Description: epitope description:VPCSICSNNPTCWAICK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 9141214;

  51. Subgroup specific protection of mice from respiratory syncytial virus infection with peptides encompassing the amino acid region 174-187 from the G gl...

    ID: 1488617

    Description: epitope description:VPCSICSNNPTCWAICK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 9141214;

  52. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489213

    Description: epitope description:HAQDGDAITMRNV antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  53. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489214

    Description: epitope description:DAITMRNVTNAWI antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  54. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489218

    Description: epitope description:AWIDHNSLSDCSD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  55. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489221

    Description: epitope description:IDVTLGSTGITIS antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  56. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489223

    Description: epitope description:TISNNHFFNHHKV antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  57. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489225

    Description: epitope description:HKVMLLGHDDTYD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  58. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489238

    Description: epitope description:SSNPTILSEGNSF antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  59. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489239

    Description: epitope description:ILSEGNSFTAPSE antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  60. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489255

    Description: epitope description:SLLQDVNNEFMEVTE antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  61. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489260

    Description: epitope description:DDFWRCTSGLPSLMK antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  62. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489261

    Description: epitope description:PSLMKTPKIRLMPGP antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  63. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489263

    Description: epitope description:PTTVDGCVRTPSLVI antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  64. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489286

    Description: epitope description:FKNNNISFDQPYAAL antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  65. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489289

    Description: epitope description:GLEHPINENAICNTT antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  66. Neutralizing epitopes of human parainfluenza virus type 3 are conformational and cannot be imitated by synthetic peptides.

    ID: 1489296

    Description: epitope description:EGRLLLLGNKIYIYT antigen name:hemagglutinin-neuraminidase host organism:Homo sapiens

    Publication: 1711742;

  67. Homology modeling and characterization of IgE binding epitopes of mountain cedar allergen Jun a 3.

    ID: 1489344

    Description: epitope description:VDGGCNSACNVFK antigen name:Jun a 3 host organism:Homo sapiens

    Publication: 10969020;

  68. Monoclonal antibody epitopes of mycobacterial 65-kD heat-shock protein defined by epitope scanning.

    ID: 1489411

    Description: epitope description:LGLKRGIEKAVE antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus antibody name:IIH9

    Publication: 1378362;

  69. Monoclonal antibody epitopes of mycobacterial 65-kD heat-shock protein defined by epitope scanning.

    ID: 1489423

    Description: epitope description:MLQDMAILTGGQVI antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus antibody name:ML30

    Publication: 1378362;

  70. Monoclonal antibody epitopes of mycobacterial 65-kD heat-shock protein defined by epitope scanning.

    ID: 1489425

    Description: epitope description:TGVYEDLLAAGVA antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus antibody name:IIC8

    Publication: 1378362;

  71. Chimeric T helper-B cell peptides induce protective response against Japanese encephalitis virus in mice.

    ID: 1489445

    Description: epitope description:AIVVEYSSSVKLT antigen name:Genome polyprotein host organism:Mus musculus antibody name:Hs-1

    Publication: 17627594;

  72. Chimeric T helper-B cell peptides induce protective response against Japanese encephalitis virus in mice.

    ID: 1489513

    Description: epitope description:EAWLDSTKAT antigen name:Genome polyprotein host organism:Mus musculus Swiss albino antibody name:Mouse sera

    Publication: 17627594;

  73. Chimeric T helper-B cell peptides induce protective response against Japanese encephalitis virus in mice.

    ID: 1489523

    Description: epitope description:SVRTTTDSGKLITD antigen name:Genome polyprotein host organism:Mus musculus Swiss albino antibody name:Mouse sera

    Publication: 17627594;

  74. Characterization of a new oriental-mustard (Brassica juncea) allergen, Bra j IE: detection of an allergenic epitope.

    ID: 1489540

    Description: epitope description:QGPHVISRIYQTAT antigen name:Sin a 1 host organism:Mus musculus BALB/c antibody name:2B3

    Publication: 7688955;

  75. Characterization of a new oriental-mustard (Brassica juncea) allergen, Bra j IE: detection of an allergenic epitope.

    ID: 1489543

    Description: epitope description:QGPHVISRIYQTAT antigen name:Sin a 1 host organism:Mus musculus BALB/c antibody name:2B3

    Publication: 7688955;

  76. Chimeric T helper-B cell peptides induce protective response against Japanese encephalitis virus in mice.

    ID: 1489551

    Description: epitope description:NHGNYSAQVGASQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 17627594;

  77. Characterization of a new oriental-mustard (Brassica juncea) allergen, Bra j IE: detection of an allergenic epitope.

    ID: 1489552

    Description: epitope description:QGPHVISRIYQTAT antigen name:Sin a 1 host organism:Homo sapiens

    Publication: 7688955;

  78. Chimeric T helper-B cell peptides induce protective response against Japanese encephalitis virus in mice.

    ID: 1489553

    Description: epitope description:NHGNYSAQVGASQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 17627594;

  79. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489559

    Description: epitope description:SERQPSL antigen name:P67 protein host organism:Mus musculus BALB/c antibody name:AR19.6, AR21.4

    Publication: 10024569;

  80. A part of the VP4 capsid protein exhibited by coxsackievirus B4 E2 is the target of antibodies contained in plasma from patients with type 1 diabetes.

    ID: 1489579

    Description: epitope description:GNSIIHYTNINYYKDAASNS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18366069;

  81. A part of the VP4 capsid protein exhibited by coxsackievirus B4 E2 is the target of antibodies contained in plasma from patients with type 1 diabetes.

    ID: 1489583

    Description: epitope description:SKFTEPVKDVMIKSLPALN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18366069;

  82. Peptides that mimic the group B streptococcal type III capsular polysaccharide antigen.

    ID: 1489596

    Description: epitope description:FDTGAFDPDWPA host organism:Mus musculus BALB/c antibody name:S7, S9

    Publication: 9551983;

  83. Characterization of a broadly reactive monoclonal antibody against norovirus genogroups I and II: recognition of a novel conformational epitope.

    ID: 1489653

    Description: epitope description:F426, P427, L527, A528, P529, G531 antigen name:Capsid protein VP1 host organism:Mus musculus antibody name:14-1

    Publication: 17855545;

  84. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489675

    Description: epitope description:LADCAVGFGSSTM antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  85. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489677

    Description: epitope description:STMGGKGGDFYTV antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  86. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489685

    Description: epitope description:IFSQNMNIKLKMP antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  87. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489696

    Description: epitope description:LHIHGCNTSVLGD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  88. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489699

    Description: epitope description:VSESIGVEPVHAQ antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  89. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489702

    Description: epitope description:DAITMRNVTNAWI antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  90. Epitope mapping and functional analysis of sigma A and sigma NS proteins of avian reovirus.

    ID: 1489705

    Description: epitope description:MLDMVDGRP antigen name:sigma-NS protein host organism:Mus musculus antibody name:1F9, H1E1

    Publication: 15680423;

  91. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489708

    Description: epitope description:RNVTNAWIDHNSL antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  92. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489719

    Description: epitope description:KSMKVTVAFNQFG antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  93. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489730

    Description: epitope description:SSNPTILSEGNSF antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  94. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489731

    Description: epitope description:ILSEGNSFTAPSE antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  95. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489734

    Description: epitope description:KKEVTKRIGCESP antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  96. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489736

    Description: epitope description:ESPSACANWVWRS antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  97. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489756

    Description: epitope description:LQPGKTS antigen name:P67 protein host organism:Mus musculus BALB/c antibody name:MAb AR22.7

    Publication: 10024569;

  98. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489760

    Description: epitope description:AFNQFGPNAGQR antigen name:Jun a 1 host organism:Mus musculus antibody name:KW-S91, KW-S95

    Publication: 15975657;

  99. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489767

    Description: epitope description:DSNWDQNRMKLAD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;

  100. Structural basis for epitope sharing between group 1 allergens of cedar pollen.

    ID: 1489770

    Description: epitope description:VGFGSSTMGGKGG antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 15975657;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston