Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of their epitope reveals the structural basis for the mechanism of action of the immunosuppressive antibodies basiliximab and daclizuma...

    ID: 1775731

    Description: epitope description:ERIYHFV antigen name:Interleukin-2 receptor subunit alpha host organism:Mus musculus BALB/c antibody name:basiliximab

    Publication: 17440057;

  2. Hypersensitivity reactions to penicillins: studies in a group of patients with negative benzylpenicillin G skin test.

    ID: 1775754

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 19646073;

  3. Hypersensitivity reactions to penicillins: studies in a group of patients with negative benzylpenicillin G skin test.

    ID: 1775949

    Description: epitope description:phenoxymethylpenicillin host organism:Homo sapiens

    Publication: 19646073;

  4. Hypersensitivity reactions to penicillins: studies in a group of patients with negative benzylpenicillin G skin test.

    ID: 1775954

    Description: epitope description:ampicillin host organism:Homo sapiens

    Publication: 19646073;

  5. Recombinant human antibodies against aldehyde-modified apolipoprotein B-100 peptide sequences inhibit atherosclerosis.

    ID: 1775957

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens antibody name:IEI-A8, IEI-G8, IEI-E3, IEI-D8

    Publication: 15451805;

  6. Recombinant human antibodies against aldehyde-modified apolipoprotein B-100 peptide sequences inhibit atherosclerosis.

    ID: 1775960

    Description: epitope description:KTTKQSFDLSVKAQYKKNKH antigen name:Apolipoprotein B-100 host organism:Homo sapiens antibody name:KTT-D6, KTT-D8

    Publication: 15451805;

  7. T cell peptide of a self-protein elicits autoantibody to the protein antigen. Implications for specificity and pathogenetic role of antibody in autoim...

    ID: 1775961

    Description: epitope description:FQIHGPR antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 7693818;

  8. Detection of various forms of brain myelin basic protein in vertebrates by electroimmunoblotting.

    ID: 1775962

    Description: epitope description:ASDYKS antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus SJL X BALB/c

    Publication: 6083464;

  9. T cell peptide of a self-protein elicits autoantibody to the protein antigen. Implications for specificity and pathogenetic role of antibody in autoim...

    ID: 1775963

    Description: epitope description:NSSSSQFQIH antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 7693818;

  10. Detection of various forms of brain myelin basic protein in vertebrates by electroimmunoblotting.

    ID: 1775970

    Description: epitope description:ASDYKS antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus SJL X BALB/c

    Publication: 6083464;

  11. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1775994

    Description: epitope description:YRAYATEP antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  12. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1776008

    Description: epitope description:YRAYA antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  13. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1776011

    Description: epitope description:RVDKVDE antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  14. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1776013

    Description: epitope description:LRAHLKQ antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  15. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776030

    Description: epitope description:YYQWAPYGYFRNAYNE host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  16. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776036

    Description: epitope description:RNAYNEIKLKESY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  17. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776037

    Description: epitope description:IKLKESNEYRNAY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  18. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776041

    Description: epitope description:PYGQWAGRNAYNETKLK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  19. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776042

    Description: epitope description:QWAPYGGRNAYNETKLK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  20. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776045

    Description: epitope description:YYYNETKLKESYKVKD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  21. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776047

    Description: epitope description:DDVTYFRTKGPGRCH host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  22. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776102

    Description: epitope description:NGDGNPREVIEDLAANNPAIQNIRLR + CYSTL(R26) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  23. Correlation of peptide specificity and IgG subclass with pathogenic and nonpathogenic autoantibodies in pemphigus vulgaris: a model for autoimmunity.

    ID: 1776106

    Description: epitope description:SQEPAGTPMFLLSRNTGEVRTLTNSLDREQ antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 7761479;

  24. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776122

    Description: epitope description:AIQNIRLRHENKDL + CYSTL(L14) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  25. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776123

    Description: epitope description:IRLRHENKDLKARL + CYSTL(L14) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  26. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776125

    Description: epitope description:NGDGNPREVIEDLAANNPAIRLR + CYSTL(R23) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  27. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776135

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  28. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776140

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  29. Very low-dose tolerance with nucleosomal peptides controls lupus and induces potent regulatory T cell subsets.

    ID: 1776142

    Description: epitope description:TYTEHAKRKTVTAMDVVYALKRQG antigen name:Histone H4 host organism:Mus musculus SNF1

    Publication: 15749855;

  30. A functional motif QLYxxYP is essential for osteopontin induced T lymphocyte activation and migration.

    ID: 1776266

    Description: epitope description:VPTQLYNLYPPL host organism:Mus musculus antibody name:F8E11

    Publication: 19285028;

  31. A functional motif QLYxxYP is essential for osteopontin induced T lymphocyte activation and migration.

    ID: 1776274

    Description: epitope description:TVKQLYTLYPAA host organism:Mus musculus antibody name:F8E11

    Publication: 19285028;

  32. Immunodominant epitopes of alpha3(IV)NC1 induce autoimmune glomerulonephritis in rats.

    ID: 1776279

    Description: epitope description:TDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASP antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 14633133;

  33. Characterization of epitopes shared by alpha-melanocyte-stimulating hormone (alpha-MSH) and the 150-kD neurofilament protein (NF150): relationship to ...

    ID: 1776284

    Description: epitope description:SYSMEHFRWG antigen name:Pro-opiomelanocortin host organism:Oryctolagus cuniculus antibody name:31H2T

    Publication: 2432275;

  34. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776505

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  35. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776506

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  36. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776595

    Description: epitope description:AGDLSKVDAKQPGDY antigen name:AhpC host organism:Homo sapiens

    Publication: 16831593;

  37. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776596

    Description: epitope description:AGDLSKVDAKQPGDY antigen name:AhpC host organism:Homo sapiens

    Publication: 16831593;

  38. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776598

    Description: epitope description:NEHPVFAYLKDKLP antigen name:Glutathione peroxidase 2 host organism:Homo sapiens

    Publication: 16831593;

  39. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776646

    Description: epitope description:CQALVRMLAKKPGWK antigen name:Cytoskeleton-associated protein 5 host organism:Homo sapiens

    Publication: 16831593;

  40. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776658

    Description: epitope description:DFTYDQVAFNGLPQF antigen name:Sucrase-isomaltase, intestinal host organism:Homo sapiens

    Publication: 16831593;

  41. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776659

    Description: epitope description:DFTYDQVAFNGLPQF antigen name:Sucrase-isomaltase, intestinal host organism:Homo sapiens

    Publication: 16831593;

  42. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776696

    Description: epitope description:LAKLAGGVAVICAGA host organism:Homo sapiens

    Publication: 16831593;

  43. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776704

    Description: epitope description:QLELTEGMRFDKGYI antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 16831593;

  44. Characterization of murine T cell responses to peptides of the variable region of self T cell receptor beta-chains.

    ID: 1776794

    Description: epitope description:GGIITQTPKFLIGQEGQKLT antigen name:T-cell receptor host organism:Mus musculus BALB/c

    Publication: 8409384;

  45. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776803

    Description: epitope description:MGPKRRQLTF antigen name:Major centromere autoantigen B host organism:Homo sapiens

    Publication: 11862315;

  46. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776805

    Description: epitope description:AKEEPKRRSA antigen name:Non-histone chromosomal protein HMG-14 host organism:Homo sapiens

    Publication: 11862315;

  47. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776818

    Description: epitope description:ISDGPSKVTL antigen name:Coilin host organism:Homo sapiens

    Publication: 11862315;

  48. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776822

    Description: epitope description:CTFVPRRKAG antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11862315;

  49. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776825

    Description: epitope description:FNTGPLSVLT antigen name:Small nuclear ribonucleoprotein Sm D2 host organism:Homo sapiens

    Publication: 11862315;

  50. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776826

    Description: epitope description:GPSRR antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 11862315;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston