Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777324

    Description: epitope description:ATRTVVKFPTKAHTT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  2. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777328

    Description: epitope description:HTTPWGLFYSWSTAS antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  3. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777330

    Description: epitope description:LFYSWSTASLDSQMP antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  4. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777332

    Description: epitope description:TASLDSQMPSSLHPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  5. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777334

    Description: epitope description:QMPSSLHPTQESTKE antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  6. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777343

    Description: epitope description:PNFTLHMESITFSKT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  7. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777345

    Description: epitope description:MESITFSKTPKSTTE antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  8. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777346

    Description: epitope description:SKTPKSTTEPTPSPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  9. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777347

    Description: epitope description:SKTPKSTTEPTPSPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  10. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777350

    Description: epitope description:SPTTSEPVPEPAPNM antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  11. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777353

    Description: epitope description:PVPEPAPNMTTLEPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  12. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777354

    Description: epitope description:PNMTTLEPTPSPTTP antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  13. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777358

    Description: epitope description:TTPEPTSEPAPSPTT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  14. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777364

    Description: epitope description:TPIPTIATSPTILVS antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  15. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777369

    Description: epitope description:LVSATSLITPKSTFL antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  16. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777371

    Description: epitope description:LITPKSTFLTTTKPV antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  17. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777372

    Description: epitope description:TFLTTTKPVSLLEST antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  18. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777375

    Description: epitope description:KPVSLLESTKKTIPE antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  19. Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

    ID: 1777383

    Description: epitope description:VLQGHLESSRNDPFL antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

    Publication: 7579346;

  20. Structural organization and Zn2+-dependent subdomain interactions involving autoantigenic epitopes in the Ring-B-box-coiled-coil (RBCC) region of Ro52...

    ID: 1777393

    Description: epitope description:WEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFL antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 15964842;

  21. Demonstration of the presence of lipid peroxide-modified proteins in human atherosclerotic lesions using a novel lipid peroxide-modified anti-peptide ...

    ID: 1777400

    Description: epitope description:KKVLGEKTENPKKFK antigen name:Other Homo sapiens (human) protein host organism:Oryctolagus cuniculus

    Publication: 10217362;

  22. Demonstration of the presence of lipid peroxide-modified proteins in human atherosclerotic lesions using a novel lipid peroxide-modified anti-peptide ...

    ID: 1777401

    Description: epitope description:KKVLGEKTENPKKFK antigen name:Other Homo sapiens (human) protein host organism:Gallus gallus

    Publication: 10217362;

  23. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777412

    Description: epitope description:NGDGNPREVIEDLAANNPAIQNIRLR + CYSTL(R26) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  24. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777413

    Description: epitope description:NGDGNPREVIEDLAANNPAIQNIRLR + CYSTL(R26) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  25. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777418

    Description: epitope description:NGDGNPREVIEDLAANNPAIQNI + CYSTL(I23) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  26. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777433

    Description: epitope description:RHENKDLKARLENAME + CYSTL(E16) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  27. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777434

    Description: epitope description:RHENKDLKARLENAME + CYSTL(E16) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  28. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777435

    Description: epitope description:RHENKDLKARLENAME + CYSTL(E16) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  29. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777444

    Description: epitope description:AIQNIRLRHENKDL + CYSTL(L14) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  30. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1777449

    Description: epitope description:IRLR + CYSTL(R4) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  31. Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

    ID: 1777454

    Description: epitope description:QYLVGERTVLAGQCYIQFLSQ antigen name:Muscarinic acetylcholine receptor M1 host organism:Homo sapiens

    Publication: 18249005;

  32. Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

    ID: 1777466

    Description: epitope description:QYFVGKRTVPPGECFIQFLSE antigen name:Muscarinic acetylcholine receptor M3 host organism:Homo sapiens

    Publication: 18249005;

  33. Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

    ID: 1777503

    Description: epitope description:QYFVGKRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Homo sapiens

    Publication: 18249005;

  34. Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

    ID: 1777507

    Description: epitope description:QYFVGKRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Homo sapiens

    Publication: 18249005;

  35. Cross-reactive epitope with Klebsiella pneumoniae nitrogenase in articular tissue of HLA-B27+ patients with ankylosing spondylitis.

    ID: 1777521

    Description: epitope description:CNSRQTDREDELI antigen name:Other Klebsiella pneumoniae protein host organism:Rattus norvegicus

    Publication: 2468338;

  36. Cross-reactive epitope with Klebsiella pneumoniae nitrogenase in articular tissue of HLA-B27+ patients with ankylosing spondylitis.

    ID: 1777522

    Description: epitope description:CNSRQTDREDELI antigen name:Other Klebsiella pneumoniae protein host organism:Rattus norvegicus

    Publication: 2468338;

  37. Cross-reactive epitope with Klebsiella pneumoniae nitrogenase in articular tissue of HLA-B27+ patients with ankylosing spondylitis.

    ID: 1777533

    Description: epitope description:KAKAQTDREDLRTLLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Rattus norvegicus

    Publication: 2468338;

  38. Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

    ID: 1777550

    Description: epitope description:DANNGNLQLRNKEVT antigen name:Lupus La protein host organism:Mus musculus A/J

    Publication: 8920873;

  39. Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

    ID: 1777551

    Description: epitope description:NANNGNLLLRNKKVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 8920873;

  40. Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

    ID: 1777557

    Description: epitope description:LEAKICHQIEYYFGDFNL antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 8920873;

  41. Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

    ID: 1777561

    Description: epitope description:NDVKNRSVYIKGFPTDATLDDIKE antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 8920873;

  42. Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

    ID: 1777565

    Description: epitope description:NANNGNLLLRNKKVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 8920873;

  43. Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

    ID: 1777568

    Description: epitope description:LEAKICHQIEYYFGDFNL antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 8920873;

  44. Atomic-level mapping of antibody epitopes on a GPCR.

    ID: 1777615

    Description: epitope description:Y10, D11, I12, N13, Y15 antigen name:C-C chemokine receptor type 5 host organism:Mus musculus antibody name:CTC8

    Publication: 19453194;

  45. Atomic-level mapping of antibody epitopes on a GPCR.

    ID: 1777619

    Description: epitope description:I36, F38, K43, E44, W62 antigen name:C-C chemokine receptor type 5 host organism:Mus musculus antibody name:45533

    Publication: 19453194;

  46. Atomic-level mapping of antibody epitopes on a GPCR.

    ID: 1777620

    Description: epitope description:K43, E44 antigen name:C-C chemokine receptor type 5 host organism:Mus musculus antibody name:2D7

    Publication: 19453194;

  47. Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

    ID: 1777648

    Description: epitope description:PRRRSRKPEA antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 17210244;

  48. Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

    ID: 1777653

    Description: epitope description:PRRRSPSPTP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 17210244;

  49. Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

    ID: 1777658

    Description: epitope description:TPGPSRRGPS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 17210244;

  50. Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

    ID: 1777659

    Description: epitope description:GPSRRGPSLG antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 17210244;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston