Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

    ID: 1489085

    Description: epitope description:DELGFMVPPGLSSE antigen name:Glycoprotein 3 host organism:Sus scrofa

    Publication: 16384621;

  2. Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

    ID: 1489091

    Description: epitope description:YEPGRSLW antigen name:Glycoprotein 3 host organism:Mus musculus BALB/c antibody name:31A2, 32D4, 32H7

    Publication: 16384621;

  3. Mapping of B-cell epitopes of hemagglutinin protein of rinderpest virus.

    ID: 1489157

    Description: epitope description:ECFPWDRKL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:E2G4

    Publication: 12127784;

  4. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489182

    Description: epitope description:QNRMKLADCAVGF antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  5. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489186

    Description: epitope description:KGGDFYTVTSTDD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  6. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496446

    Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  7. Determination of neutralizing epitopes in variable domains I and IV of the major outer-membrane protein from Chlamydia trachomatis serovar K.

    ID: 1496488

    Description: epitope description:LDVTTLNPTI host organism:Mus musculus BALB/c antibody name:5C2, DP10

    Publication: 7524957;

  8. Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

    ID: 1496508

    Description: epitope description:GREKFTIRPHYGKEIPFVPRADEPARKGKVH host organism:Mus musculus BALB/c

    Publication: 7690411;

  9. Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

    ID: 1496518

    Description: epitope description:PFVPRADEPARKGKVHGREKFTIRPHYGKEI host organism:Mus musculus BALB/c

    Publication: 7690411;

  10. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496608

    Description: epitope description:FFWPKDFTFVCPTEI antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston