Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489771

Description: epitope description:STMGGKGGDFYTV antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489774

Description: epitope description:TDDNPVNPTPGTL antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489775

Description: epitope description:VNPTPGTLRYGAT antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489783

Description: epitope description:GADVHLGNGGPCL antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489785

Description: epitope description:PCLFMRKVSHVIL antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489791

Description: epitope description:LGDVLVSESIGVE antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489792

Description: epitope description:VSESIGVEPVHAQ antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489796

Description: epitope description:RNVTNAWIDHNSL antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489800

Description: epitope description:IDVTLGSTGITIS antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489801

Description: epitope description:GSTGITISNNHFF antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489805

Description: epitope description:LGHDDTYDDDKSM antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489806

Description: epitope description:TYDDDKSMKVTVA antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489807

Description: epitope description:KSMKVTVAFNQFG antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489808

Description: epitope description:TVAFNQFGPNAGQ antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489810

Description: epitope description:AGQRMPRARYGLV antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489814

Description: epitope description:DPWNIYAIGGSSN antigen name:Jun a 1 host organism:Homo sapiens

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489816

Description: epitope description:SSNPTILSEGNSF antigen name:Jun a 1 host organism:Homo sapiens

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489836

Description: epitope description:LKKTLQPGKTSTGET antigen name:P67 protein host organism:Bos taurus antibody name:bovine antiserum BL 281

Structural basis for epitope sharing between group 1 allergens of cedar pollen.

ID: 1489837

Description: epitope description:AFNQFGPNAGQR antigen name:Jun a 1 host organism:Mus musculus antibody name:KW-S91, KW-S95

T cell epitope-based peptide-DNA dual vaccine induces protective immunity against Schistosoma japonicum infection in C57BL/6J mice.

ID: 1488622

Description: epitope description:AKQYNICCKFKELLD antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

Fine-epitope mapping of an antibody that binds the ectodomain of influenza matrix protein 2.

ID: 1488636

Description: epitope description:EVETPIRN antigen name:Matrix protein 2 host organism:Mus musculus BALB/c antibody name:8C6

Anti-hepatitis A virus antibody response elicited in mice by different forms of a synthetic VP1 peptide.

ID: 1488643

Description: epitope description:TVSTEQNVPDPQVGI antigen name:Genome polyprotein host organism:Mus musculus antibody name:anti-VP1 peptide

The neutralizing antibody response against West Nile virus in naturally infected horses.

ID: 1488681

Description: epitope description:S306, K307, T330, T332 antigen name:Genome polyprotein host organism:Equus caballus antibody name:Horse sera

Mapping of a type 1-specific and a type-common epitope on the E2 (gp53) protein of bovine viral diarrhea virus with neutralization escape mutants.

ID: 1488716

Description: epitope description:E69, R70, L72, S75 antigen name:putative polyprotein host organism:Mus musculus BALB/c antibody name:mAb 348

Mapping of a type 1-specific and a type-common epitope on the E2 (gp53) protein of bovine viral diarrhea virus with neutralization escape mutants.

ID: 1488717

Description: epitope description:S9, E32, R72 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mAb 157

Mapping of a type 1-specific and a type-common epitope on the E2 (gp53) protein of bovine viral diarrhea virus with neutralization escape mutants.

ID: 1488718

Description: epitope description:E69, R70, L72, S75 antigen name:putative polyprotein host organism:Mus musculus BALB/c antibody name:mAb 348

Inhibition of mucosal and systemic T(h)2-type immune responses by intranasal peptides containing a dominant T cell epitope of the allergen Der p 1.

ID: 1488721

Description: epitope description:SNYCQIYPPNANKIR antigen name:Der p 1 host organism:Mus musculus C57BL/6

Single-amino-acid mutation in the HA alters the recognition of H9N2 influenza virus by a monoclonal antibody.

ID: 1488755

Description: epitope description:S145 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:C/B3

Identification of a dominant epitope in human vaccinia-related kinase 1 (VRK1) and detection of different intracellular subpopulations.

ID: 1488804

Description: epitope description:T355 antigen name:Serine/threonine-protein kinase VRK1 host organism:Mus musculus BALB/c antibody name:1B5, 1F6

Identification of immunoglobulin E (IgE)-binding epitopes and recombinant IgE reactivities of a latex cross-reacting Indian jujube Ziz m 1 allergen.

ID: 1488856

Description: epitope description:VWNRYYDLKT antigen name:Ziz m 1 host organism:Homo sapiens

Identification of immunoglobulin E (IgE)-binding epitopes and recombinant IgE reactivities of a latex cross-reacting Indian jujube Ziz m 1 allergen.

ID: 1488857

Description: epitope description:KTNYSSSIILEY antigen name:Ziz m 1 host organism:Homo sapiens

Identification of immunoglobulin E (IgE)-binding epitopes and recombinant IgE reactivities of a latex cross-reacting Indian jujube Ziz m 1 allergen.

ID: 1488860

Description: epitope description:GGIATYWGQYTETEEGSLAEACASNLYSYINIAYLNIFGEGRYLSL antigen name:Ziz m 1 host organism:Homo sapiens

Selection of immunodominant mimics of IROMP-99 of rabbit Pasteurella multocida from a random 12-peptide library.

ID: 1488865

Description: epitope description:WHQTTPQPYLPG host organism:Rattus norvegicus

Selection of immunodominant mimics of IROMP-99 of rabbit Pasteurella multocida from a random 12-peptide library.

ID: 1488866

Description: epitope description:WHATTPFPPPPE host organism:Rattus norvegicus

Characterization of the immunodominant cross-reacting epitope of visna maedi virus and caprine arthritis-encephalitis virus capsid antigen.

ID: 1488909

Description: epitope description:LNEEAERWVRQNPPGPN antigen name:gag protein host organism:Capra hircus antibody name:Goat sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488934

Description: epitope description:DEKELKKTLQPGKTS antigen name:P67 protein host organism:Mus musculus BALB/c antibody name:MAb AR22.7

GB virus C (GBV-C) / hepatitis G virus (HGV): towards the design of synthetic peptides-based biosensors for immunodiagnosis of GBV-C/HGV infection.

ID: 1488945

Description: epitope description:AIAYYRGKDSSIIKDGDLVVC antigen name:Pegivirus C protein host organism:Homo sapiens antibody name:Human sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488948

Description: epitope description:TKEEVPPADLSDQVP antigen name:P67 protein host organism:Mus musculus BALB/c antibody name:TpM12

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488951

Description: epitope description:EEEVKKILDEIVKDP antigen name:P67 protein host organism:Mus musculus BALB/c antibody name:MAb 38.9

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488961

Description: epitope description:EQPFPSRLGPLVTLE antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488971

Description: epitope description:NVKQQQDTKGNRSDS antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488973

Description: epitope description:EENEDSTLSTDVSPT antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488974

Description: epitope description:STDVSPTIPTPVSEE antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488975

Description: epitope description:PTPVSEEIITPTLQA antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488979

Description: epitope description:RDGDGRVIEPKIGLP antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488984

Description: epitope description:GGEQPPSAPNGTATG antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488996

Description: epitope description:GETTSGQDLNSKQQQ antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488997

Description: epitope description:LNSKQQQTGVSDLAS antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1488998

Description: epitope description:GVSDLASGSHSSGLK antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489002

Description: epitope description:LASNTSREGQAQHQQ antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489025

Description: epitope description:ELKKFLFEELESLVN antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489028

Description: epitope description:ASDFVEITDGLRKNT antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489040

Description: epitope description:ANELLLAMEKIVVPP antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489044

Description: epitope description:IAYYATKDILSSIEN antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489048

Description: epitope description:QVRNSLRMVPHQMNL antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489051

Description: epitope description:SDMMRRRGTASQDEP antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489052

Description: epitope description:TASQDEPAGAGSGVT antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

Identification of amino acid residues important to the neuraminidase activity of the HN glycoprotein of Newcastle disease virus.

ID: 1489056

Description: epitope description:H200 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:HN23a, HN23c, HN23d, HN23d, HN23e, H...

Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

ID: 1489063

Description: epitope description:KLKKKLLGSGFEVAS antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

A protective anti-peptide antibody against the immunodominant site of the A24 Cruzeiro strain of foot-and-mouth disease virus and its reactivity with ...

ID: 1489079

Description: epitope description:GSLAAR antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:C1.1

Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

ID: 1489085

Description: epitope description:DELGFMVPPGLSSE antigen name:Glycoprotein 3 host organism:Sus scrofa

Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

ID: 1489091

Description: epitope description:YEPGRSLW antigen name:Glycoprotein 3 host organism:Mus musculus BALB/c antibody name:31A2, 32D4, 32H7

Mapping of B-cell epitopes of hemagglutinin protein of rinderpest virus.

ID: 1489157

Description: epitope description:ECFPWDRKL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:E2G4

Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

ID: 1489182

Description: epitope description:QNRMKLADCAVGF antigen name:Jun a 1 host organism:Homo sapiens

Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

ID: 1489186

Description: epitope description:KGGDFYTVTSTDD antigen name:Jun a 1 host organism:Homo sapiens

Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

ID: 1496446

Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

Determination of neutralizing epitopes in variable domains I and IV of the major outer-membrane protein from Chlamydia trachomatis serovar K.

ID: 1496488

Description: epitope description:LDVTTLNPTI host organism:Mus musculus BALB/c antibody name:5C2, DP10

Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

ID: 1496508

Description: epitope description:GREKFTIRPHYGKEIPFVPRADEPARKGKVH host organism:Mus musculus BALB/c

Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

ID: 1496518

Description: epitope description:PFVPRADEPARKGKVHGREKFTIRPHYGKEI host organism:Mus musculus BALB/c

A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

ID: 1496608

Description: epitope description:FFWPKDFTFVCPTEI antigen name:AhpC host organism:Mus musculus C57BL/6

The effect of orientation within a chimeric peptide on the immunogenicity of Chlamydia trachomatis epitopes.

ID: 1496610

Description: epitope description:SATAIFDTTTLNPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

ID: 1496621

Description: epitope description:QVLGVSIDSEFVHFN antigen name:AhpC host organism:Mus musculus C57BL/6

The effect of orientation within a chimeric peptide on the immunogenicity of Chlamydia trachomatis epitopes.

ID: 1496631

Description: epitope description:VAGLQNDPT host organism:Mus musculus C57BL/10

A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

ID: 1496635

Description: epitope description:LPFPMLSDIKRELSL antigen name:AhpC host organism:Mus musculus C57BL/6

A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

ID: 1496643

Description: epitope description:ADRATFIVDPNNEIQ antigen name:AhpC host organism:Mus musculus C57BL/6

Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

ID: 1496671

Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

Identification of surface-exposed B-cell epitopes recognized by Haemophilus influenzae type b P1-specific monoclonal antibodies.

ID: 1496715

Description: epitope description:VKTIGDKRTLTLNTTANYT antigen name:Outer membrane protein P1 host organism:Mus musculus BALB/c antibody name:3E12

Naturally occurring MHR variants in Turkish patients infected with hepatitis B virus.

ID: 1496732

Description: epitope description:S143 antigen name:Large envelope protein host organism:Mus musculus antibody name:Vitros ECi/HBsAg

Characterization of cross-reactive and serotype-specific epitopes on the nucleocapsid proteins of hantaviruses.

ID: 1496733

Description: epitope description:QLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETKLG antigen name:Andes orthohantavirus protein host organism:Mus musculus antibody name:7E...

Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

ID: 1496783

Description: epitope description:DKEYGVLNNSD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.1

Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

ID: 1496789

Description: epitope description:KRIPNKKPGKKTTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

ID: 1496796

Description: epitope description:HKVNSQVEAGSKATWN antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

ID: 1496797

Description: epitope description:HKVNSQVEAGSKATWN antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

ID: 1496800

Description: epitope description:THKVGTSFTFES antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

ID: 1496801

Description: epitope description:THKVGTSFTFES antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

ID: 1496802

Description: epitope description:KRIPNKKPGKKTTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

ID: 1496807

Description: epitope description:KPTKKPTFKTTKKDLKPQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

ID: 1496808

Description: epitope description:KPTKKPTFKTTKKDLKPQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

ID: 1496811

Description: epitope description:KPTTKQRQNKPPNKPN antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

ID: 1496827

Description: epitope description:DKEYGVLNNSD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.1

Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

ID: 1496833

Description: epitope description:KRPNDKAG antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.5

Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

ID: 1496835

Description: epitope description:TTETGKGV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.6

IgE binding structures of the major house dust mite allergen Der p I.

ID: 1496859

Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens

Localization of conserved B-cell epitopes among encapsulated and non-encapsulated Haemophilus influenzae P2 porin proteins using synthetic peptides.

ID: 1496939

Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-17

Studies on the primary structure and antigenic determinants of pilin isolated from Pseudomonas aeruginosa K.

ID: 1497041

Description: epitope description:EVPLGVAADANK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus New Zealand White

Different rhinovirus serotypes neutralized by antipeptide antibodies.

ID: 1497149

Description: epitope description:KLILAYTPPGARGPQD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Different rhinovirus serotypes neutralized by antipeptide antibodies.

ID: 1497155

Description: epitope description:KLILAYTPPGARGPQD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Syntheses of immunodominant peptide regions of hepatitis C viral pathogens using PS-BDODMA resin: a single peptide derived from the conserved domain (...

ID: 1497221

Description: epitope description:HTPGCVPCVREGNSSRCWVALTPTLVA antigen name:Genome polyprotein host organism:Homo sapiens

Antigen-antibody interactions: elucidation of the epitope and strain-specificity of a monoclonal antibody directed against the pilin protein adherence...

ID: 1497223

Description: epitope description:DNKYLPK antigen name:UniProt:M9S5B0 host organism:Mus musculus BALB/c antibody name:PK99H

Antigen-antibody interactions: elucidation of the epitope and strain-specificity of a monoclonal antibody directed against the pilin protein adherence...

ID: 1497225

Description: epitope description:DAKFRPN antigen name:UniProt:W5V4N0 host organism:Mus musculus BALB/c antibody name:PK99H