Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496833

    Description: epitope description:KRPNDKAG antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.5

    Publication: 1375930;
  2. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496835

    Description: epitope description:TTETGKGV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.6

    Publication: 1375930;
  3. IgE binding structures of the major house dust mite allergen Der p I.

    ID: 1496859

    Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens

    Publication: 1371823;
  4. Localization of conserved B-cell epitopes among encapsulated and non-encapsulated Haemophilus influenzae P2 porin proteins using synthetic peptides.

    ID: 1496939

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-17

    Publication: 1372928;
  5. Studies on the primary structure and antigenic determinants of pilin isolated from Pseudomonas aeruginosa K.

    ID: 1497041

    Description: epitope description:EVPLGVAADANK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2410087;
  6. Different rhinovirus serotypes neutralized by antipeptide antibodies.

    ID: 1497149

    Description: epitope description:KLILAYTPPGARGPQD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2444889;
  7. Different rhinovirus serotypes neutralized by antipeptide antibodies.

    ID: 1497155

    Description: epitope description:KLILAYTPPGARGPQD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2444889;
  8. Syntheses of immunodominant peptide regions of hepatitis C viral pathogens using PS-BDODMA resin: a single peptide derived from the conserved domain (...

    ID: 1497221

    Description: epitope description:HTPGCVPCVREGNSSRCWVALTPTLVA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 11168897;
  9. Antigen-antibody interactions: elucidation of the epitope and strain-specificity of a monoclonal antibody directed against the pilin protein adherence...

    ID: 1497223

    Description: epitope description:DNKYLPK antigen name:UniProt:M9S5B0 host organism:Mus musculus BALB/c antibody name:PK99H

    Publication: 1284654;
  10. Antigen-antibody interactions: elucidation of the epitope and strain-specificity of a monoclonal antibody directed against the pilin protein adherence...

    ID: 1497225

    Description: epitope description:DAKFRPN antigen name:UniProt:W5V4N0 host organism:Mus musculus BALB/c antibody name:PK99H

    Publication: 1284654;

Displaying 10 of 1,510,353 results for " "