Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274558

    Description: epitope description:R297, H298, W299, T300, T301, Q302, G303, C304, N305, C306, P480, D481, Q482, R483, P484, Y485, C486, W487, H488, Y489, P490, P491...

    Publication: 12882983;

  2. Identification of two immunogenic domains of the prion protein--PrP--which activate class II-restricted T cells and elicit antibody responses against ...

    ID: 1274610

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 15075357;

  3. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274623

    Description: epitope description:YEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SHA-31

    Publication: 15140886;

  4. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274658

    Description: epitope description:KPSKPKTNMKHMAGAA antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus antibody na...

    Publication: 8645112;

  5. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274660

    Description: epitope description:ETDVKMMERV antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab. Mo-V

    Publication: 8645112;

  6. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274661

    Description: epitope description:ETDVKMMERV antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab. Mo-V

    Publication: 8645112;

  7. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1274730

    Description: epitope description:VDQYSNQNNF antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab165-174

    Publication: 7535178;

  8. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1274738

    Description: epitope description:CVTQYQKESQAYYD antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab213-226

    Publication: 7535178;

  9. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274745

    Description: epitope description:PTHYISTSL host organism:Homo sapiens

    Publication: 8666827;

  10. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274746

    Description: epitope description:PSHYVPRIY host organism:Homo sapiens

    Publication: 8666827;

  11. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274749

    Description: epitope description:PTHYISSRH host organism:Mus musculus BALB/c

    Publication: 8666827;

  12. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274752

    Description: epitope description:NKTKQNPNL host organism:Mus musculus BALB/c

    Publication: 8666827;

  13. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274753

    Description: epitope description:NKTKQNPNL host organism:Homo sapiens

    Publication: 8666827;

  14. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274755

    Description: epitope description:KLRRSTNWG host organism:Homo sapiens

    Publication: 8666827;

  15. Breaking immune tolerance to the prion protein using prion protein peptides plus oligodeoxynucleotide-CpG in mice.

    ID: 1274771

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 15100253;

  16. Breaking immune tolerance to the prion protein using prion protein peptides plus oligodeoxynucleotide-CpG in mice.

    ID: 1274776

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 15100253;

  17. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274781

    Description: epitope description:SPLRRHYELPLIQ host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  18. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274784

    Description: epitope description:SQRSRHWHDVPK host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  19. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274788

    Description: epitope description:WHRTPSTLWGVI host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  20. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274796

    Description: epitope description:HLYHKNRNHIAY host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston