The nature of the immunogen determines the specificity of antibodies and T cells to selected peptides of the 38 kDa mycobacterial antigen.

ID: 1377983

Description: epitope description:MKIRLHTLLAVLTAAPLLLA antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10

Synthesis and comparison of antibody recognition of conjugates containing herpes simplex virus type 1 glycoprotein D epitope VII.

ID: 1404124

Description: epitope description:LKMADPNRFRG antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:A16

Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

ID: 1404280

Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

ID: 1404281

Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

Recognition of human cytomegalovirus by human primary immunoglobulins identifies an innate foundation to an adaptive immune response.

ID: 1404405

Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens