Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783038

    Description: epitope description:QVDFQKTMKVTGVTTQGVKS antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  2. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783041

    Description: epitope description:LISSSQDGHQWTLFFQNGKV antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  3. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783042

    Description: epitope description:WTLFFQNGKVKVFQGNQDSF antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  4. Fine mapping of monoclonal antibody epitopes on human von Willebrand factor using a recombinant peptide library.

    ID: 1783073

    Description: epitope description:QPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDA antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:RG38

    Publication: 1377414;

  5. Fine mapping of monoclonal antibody epitopes on human von Willebrand factor using a recombinant peptide library.

    ID: 1783075

    Description: epitope description:DMAQVTVGPGLLGVSTL antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:RG49

    Publication: 1377414;

  6. Differing epitope selection of experimentally-induced and natural antibodies to a disease-specific autoantigen, the E2 subunit of pyruvate dehydrogena...

    ID: 1783085

    Description: epitope description:IETDKTSVQV antigen name:Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitocho...

    Publication: 1282029;

  7. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783111

    Description: epitope description:MPKFYCDYCD antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  8. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783241

    Description: epitope description:PGMMPAPHMG antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  9. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783300

    Description: epitope description:GGHMPMMPGP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  10. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783309

    Description: epitope description:MPGPPMMRPP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  11. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783316

    Description: epitope description:MRPPARPMMV antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  12. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783318

    Description: epitope description:MRPPARPMMV antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  13. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783320

    Description: epitope description:PPARPMMVPT antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  14. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783324

    Description: epitope description:ARPMMVPTRP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  15. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783325

    Description: epitope description:PMMVPTRPGM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  16. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783253

    Description: epitope description:MGGPPMMPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  17. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783256

    Description: epitope description:GPPMMPMMGP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  18. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783261

    Description: epitope description:PMMPMMGPPP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  19. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783292

    Description: epitope description:RPPMGGHMPM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  20. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783339

    Description: epitope description:YCDYCDTYLTHDSPSVRKTHCSGRKHKENV antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  21. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783340

    Description: epitope description:CSGRKHKENVKDYYQK antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  22. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783344

    Description: epitope description:KENVKDYYQKWMEEQAQS antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  23. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783347

    Description: epitope description:KWMEEQAQSLIDKTTA antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  24. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783350

    Description: epitope description:EQAQSLIDKTTAAFQQGKI antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  25. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783358

    Description: epitope description:AGAMIPPPPSLPGPPR antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  26. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783359

    Description: epitope description:AGAMIPPPPSLPGPPR antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  27. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783361

    Description: epitope description:GPPRPGMMPAPHMGGPPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  28. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783367

    Description: epitope description:GPPPPGMMPVGPAPGMRPPMG antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  29. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783372

    Description: epitope description:VGPAPGMRPPMGGHMPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  30. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783382

    Description: epitope description:PMMPGPPMMRPPARPMMVPTRP antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus

    Publication: 8960101;

  31. Differing epitope selection of experimentally-induced and natural antibodies to a disease-specific autoantigen, the E2 subunit of pyruvate dehydrogena...

    ID: 1783394

    Description: epitope description:TPAAT antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial host o...

    Publication: 1282029;

  32. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783409

    Description: epitope description:AGAMIPPPPS antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus

    Publication: 8960101;

  33. Fine mapping of monoclonal antibody epitopes on human von Willebrand factor using a recombinant peptide library.

    ID: 1783411

    Description: epitope description:QPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDA antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:RG38

    Publication: 1377414;

  34. Specific serum IgE levels and FcepsilonRIbeta genetic polymorphism in patients with penicillins allergy.

    ID: 1783419

    Description: epitope description:ampicillanyl group host organism:Homo sapiens

    Publication: 15507102;

  35. Specific serum IgE levels and FcepsilonRIbeta genetic polymorphism in patients with penicillins allergy.

    ID: 1783420

    Description: epitope description:amoxicillanyl group host organism:Homo sapiens

    Publication: 15507102;

  36. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783562

    Description: epitope description:EDWDYAPLVLAPDDRSYKSQ antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  37. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783566

    Description: epitope description:YTDETFKTREAIQHESGILG antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  38. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783571

    Description: epitope description:TDVRPLYSRRLPKGVKHLKD antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  39. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783574

    Description: epitope description:YKWTVTVEDGPTKSDPRCLT antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  40. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783576

    Description: epitope description:RYYSSFVNMERDLASGLIGP antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  41. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783578

    Description: epitope description:LLICYKESVDQRGNQIMSDK antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  42. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783579

    Description: epitope description:QRGNQIMSDKRNVILFSVFD antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  43. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783583

    Description: epitope description:VQLEDPEFQASNIMHSINGY antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  44. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783585

    Description: epitope description:SIGAQTDFLSVFFSGYTFKH antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  45. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783586

    Description: epitope description:VFFSGYTFKHKMVYEDTLTL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  46. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783602

    Description: epitope description:LLTSMYVKEFLISSSQDGHQ antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  47. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783603

    Description: epitope description:LISSSQDGHQWTLFFQNGKV antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  48. Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10.

    ID: 1783629

    Description: epitope description:R32, H33, G34, N37, Y38, R39, W80, W81, R91, L93, N95, T107, N111, K114, K115, I116, S118, D119, G120 antigen name:Gal d 4 host or...

    Publication: 18227432;

  49. Definition of a nonlinear conformational epitope for the apolipoprotein B-100-specific monoclonal antibody, MB47.

    ID: 1783655

    Description: epitope description:T3429, K3430, A3431, Q3432, I3433, P3434, I3435, L3436, R3437, M3438, N3439, F3440, K3441, Q3442, E3443, L3444, N3445, G3446, N344...

    Publication: 7516960;

  50. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783698

    Description: epitope description:AGLGAGIP antigen name:Elastin (UniProt:P15502) host organism:Mus musculus BALB/c antibody name:G8.1

    Publication: 9430493;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston