Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497564

    Description: epitope description:ITTYV antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  2. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497594

    Description: epitope description:HSKKVPNKDRRRRVPKEKFFCDSSKNYTKWNKDI antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody nam...

    Publication: 16938323;

  3. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497615

    Description: epitope description:LIRLNRPVRKSAHIAPLSLPSSPPSVGSVCRIM antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name...

    Publication: 16938323;

  4. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497645

    Description: epitope description:AQPHEPGSYTNVF antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name:anti-elegaxobin II ...

    Publication: 16938323;

  5. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497646

    Description: epitope description:SWGGDPCAQPHEPGSYTNV antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name:anti-elegaxob...

    Publication: 16938323;

  6. Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

    ID: 1497684

    Description: epitope description:NWNFD antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-50, RV-1026

    Publication: 1378880;

  7. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497713

    Description: epitope description:LKLYFEP antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  8. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497787

    Description: epitope description:GQSRKPGIYTKVFDYNAWIQ antigen name:Thrombin-like enzyme flavoxobin host organism:Oryctolagus cuniculus antibody name:anti-elegaxobi...

    Publication: 16938323;

  9. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497789

    Description: epitope description:SSATK antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  10. Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

    ID: 1497797

    Description: epitope description:IRNW antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

    Publication: 1378880;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston