Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783712

    Description: epitope description:LGGLGVG antigen name:Elastin (UniProt:P15502) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9430493;

  2. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783713

    Description: epitope description:VPGVGGLG antigen name:Elastin (UniProt:P15502) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9430493;

  3. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783716

    Description: epitope description:AAKAAA antigen name:Elastin (UniProt:P15502) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9430493;

  4. Production and characterisation of monoclonal and polyclonal amtobpdoes agaomst bovine osteocalcin.

    ID: 1783720

    Description: epitope description:PLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV + MCM(E3, E7, E10) antigen name:Osteocalcin host organism:Mus musculus BALB/c

    Publication: 19856292;

  5. Production and characterisation of monoclonal and polyclonal amtobpdoes agaomst bovine osteocalcin.

    ID: 1783721

    Description: epitope description:PLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV + MCM(E3, E7, E10) antigen name:Osteocalcin host organism:Oryctolagus cuniculus Danish White

    Publication: 19856292;

  6. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783724

    Description: epitope description:CLGKAC antigen name:Elastin (UniProt:P15502) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9430493;

  7. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783741

    Description: epitope description:VTFPGA antigen name:Elastin (UniProt:P15502) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9430493;

  8. Evaluation of the immunologic cross-reactivity of aztreonam in patients with cystic fibrosis who are allergic to penicillin and/or cephalosporin antib...

    ID: 1783752

    Description: epitope description:aztreonyl group host organism:Homo sapiens

    Publication: 2068466;

  9. Evaluation of the immunologic cross-reactivity of aztreonam in patients with cystic fibrosis who are allergic to penicillin and/or cephalosporin antib...

    ID: 1783758

    Description: epitope description:azlocillin host organism:Homo sapiens

    Publication: 2068466;

  10. Immunogenic display of diverse peptides, including a broadly cross-type neutralizing human papillomavirus L2 epitope, on virus-like particles of the R...

    ID: 1783771

    Description: epitope description:QLYKTCKQAGTCPPD antigen name:Minor capsid protein L2 host organism:Mus musculus C57BL/6

    Publication: 20434554;

  11. Multiple autoepitope presentation for specific detection of antibodies in primary biliary cirrhosis.

    ID: 1783778

    Description: epitope description:AEIETDKATIGFEVQEEG antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitocho...

    Publication: 1280244;

  12. Multiple autoepitope presentation for specific detection of antibodies in primary biliary cirrhosis.

    ID: 1783779

    Description: epitope description:AEIETDKATIGFEVQEEG antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitocho...

    Publication: 1280244;

  13. Multiple autoepitope presentation for specific detection of antibodies in primary biliary cirrhosis.

    ID: 1783780

    Description: epitope description:AEVETDKATVGFE antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondria...

    Publication: 1280244;

  14. Multiple autoepitope presentation for specific detection of antibodies in primary biliary cirrhosis.

    ID: 1783784

    Description: epitope description:AEVETDKATVGFE antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondria...

    Publication: 1280244;

  15. Multiple autoepitope presentation for specific detection of antibodies in primary biliary cirrhosis.

    ID: 1783788

    Description: epitope description:AEVETDKATVGFE antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondria...

    Publication: 1280244;

  16. Antibodies to staphylococcal peptidoglycan and its peptide epitopes, teichoic acid, and lipoteichoic acid in sera from blood donors and patients with ...

    ID: 1783802

    Description: epitope description:L-lysyl-D-alanine antigen name:peptidoglycan host organism:Homo sapiens

    Publication: 2473994;

  17. Saga of a sperm fertility biomarker.

    ID: 1783814

    Description: epitope description:RAGIKVTVAGLAGKD antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  18. Saga of a sperm fertility biomarker.

    ID: 1783823

    Description: epitope description:DTSLEEAKTQGPYDV antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  19. Saga of a sperm fertility biomarker.

    ID: 1783826

    Description: epitope description:QGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  20. Saga of a sperm fertility biomarker.

    ID: 1783828

    Description: epitope description:VVLPGGNLGAQNLSE antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  21. Saga of a sperm fertility biomarker.

    ID: 1783830

    Description: epitope description:NLGAQNLSESALVKE antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  22. Saga of a sperm fertility biomarker.

    ID: 1783831

    Description: epitope description:AQNLSESALVKEILK antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  23. Saga of a sperm fertility biomarker.

    ID: 1783832

    Description: epitope description:LSESALVKEILKEQE antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  24. Anti-cardiolipin antibodies in neurological disorders: cross-reaction with anti-single stranded DNA activity.

    ID: 1784621

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3498571;

  25. Anti-cardiolipin antibodies in neurological disorders: cross-reaction with anti-single stranded DNA activity.

    ID: 1784624

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3498571;

  26. Anti-cardiolipin antibodies in neurological disorders: cross-reaction with anti-single stranded DNA activity.

    ID: 1784625

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3498571;

  27. Recurrent stroke and multi-infarct dementia in systemic lupus erythematosus: association with antiphospholipid antibodies.

    ID: 1784630

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3116954;

  28. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784638

    Description: epitope description:RRRSRKPEAPRRRSP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  29. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784646

    Description: epitope description:RRGPSLGASSHQHSR antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  30. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784647

    Description: epitope description:PSLGASSHQHSRRRQ antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  31. Venous thrombosis associated with lupus anticoagulant and anticardiolipin antibodies.

    ID: 1784648

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3144118;

  32. Venous thrombosis associated with lupus anticoagulant and anticardiolipin antibodies.

    ID: 1784649

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3144118;

  33. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784653

    Description: epitope description:RRQGWLKEIRKLQKS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  34. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784655

    Description: epitope description:KEIRKLQKSTHLLIR antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  35. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784675

    Description: epitope description:AYLLTLHAGRVTLFP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  36. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784677

    Description: epitope description:HAGRVTLFPKDVQLA antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  37. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784679

    Description: epitope description:LFPKDVQLARRIRGL antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens Caucasian

    Publication: 12124871;

  38. Binding specificity of lupus anticoagulants and anticardiolipin antibodies.

    ID: 1784681

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3148207;

  39. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784689

    Description: epitope description:VKDEPQRRSA antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens Caucasian

    Publication: 12124871;

  40. Development of a CENP-A/CENP-B-specific immune response in a patient with systemic sclerosis.

    ID: 1784691

    Description: epitope description:FIDEPRRRPI antigen name:Alanine--tRNA ligase, cytoplasmic host organism:Homo sapiens Caucasian

    Publication: 12124871;

  41. Immunodominant structures in the aminoterminal portion of human interferon alpha 1.

    ID: 1784704

    Description: epitope description:QIFNL antigen name:Interferon alpha-2 host organism:Mus musculus BALB/c antibody name:1-9, 2-52

    Publication: 1378930;

  42. Evidence for specific polypeptide chain folding in myelin basic protein from reactions between fragments of the protein and monoclonal antibodies.

    ID: 1784705

    Description: epitope description:VVHFFKNIV antigen name:Myelin basic protein host organism:Mus musculus antibody name:18.25

    Publication: 2426407;

  43. Evidence for specific polypeptide chain folding in myelin basic protein from reactions between fragments of the protein and monoclonal antibodies.

    ID: 1784706

    Description: epitope description:VVHFFKNIV antigen name:Myelin basic protein host organism:Mus musculus antibody name:18.25

    Publication: 2426407;

  44. Immunodominant structures in the aminoterminal portion of human interferon alpha 1.

    ID: 1784712

    Description: epitope description:KDRHDFGF antigen name:Interferon alpha-2 host organism:Mus musculus BALB/c antibody name:1-46, 2-2

    Publication: 1378930;

  45. Structure of an epitope in an immunodominant region of the interferon-gamma molecule that is involved in receptor interaction.

    ID: 1784718

    Description: epitope description:TVIESLESLNNY antigen name:Interferon gamma host organism:Cricetulus migratorius antibody name:mAb 5.102.12

    Publication: 1692866;

  46. Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

    ID: 1784720

    Description: epitope description:CYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQ antigen name:Interferon gamma host organism:Cricetulus migratorius antibody name:mAbs 5.74...

    Publication: 2420886;

  47. Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

    ID: 1784721

    Description: epitope description:CYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQ antigen name:Interferon gamma host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2420886;

  48. Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

    ID: 1784729

    Description: epitope description:CYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQ antigen name:Interferon gamma host organism:Cricetulus migratorius antibody name:mAbs 5.74...

    Publication: 2420886;

  49. Impact of quaternary organization on the antigenic structure of the tick-borne encephalitis virus envelope glycoprotein E.

    ID: 1784754

    Description: epitope description:D461 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IC3

    Publication: 19553320;

  50. Impact of quaternary organization on the antigenic structure of the tick-borne encephalitis virus envelope glycoprotein E.

    ID: 1784758

    Description: epitope description:A403 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IE3

    Publication: 19553320;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston