Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498111

    Description: epitope description:GDLRAYKMVYATNPQTQLSN antigen name:Serotype 2 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  2. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498118

    Description: epitope description:QALGALKLYFEPGITTNYDTGDLIAYKQTYNASGN antigen name:Serotype 3 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  3. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498137

    Description: epitope description:RGDLQVLAQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  4. The major outer membrane protein of a single Chlamydia trachomatis serovar can possess more than one serovar-specific epitope.

    ID: 1498140

    Description: epitope description:NQSTVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c antibody name:EL11

    Publication: 8550205;

  5. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498144

    Description: epitope description:SYMDTPSTCLAIVYRPIGVP antigen name:Protein Rex host organism:Homo sapiens

    Publication: 7622904;

  6. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498153

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  7. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498155

    Description: epitope description:VLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  8. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498165

    Description: epitope description:GRVVSSPLQYLIPRLPSFPT antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  9. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498172

    Description: epitope description:DDLPTTMFQPVRAPCIQTAW antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  10. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498173

    Description: epitope description:IQTAWCTGLLPYHSILTTPG antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston