Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408106

Description: epitope description:NPVYLIPET antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit anti...

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408204

Description: epitope description:QQSPEQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408209

Description: epitope description:QQPPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408210

Description: epitope description:QQFHQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Humoral and cellular immune responses to synthetic peptides of the Leishmania donovani kinetoplastid membrane protein-11.

ID: 1408569

Description: epitope description:MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDES antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens antibody name:Hum...