Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Detection of the myristylated gag-raf transforming protein with raf-specific antipeptide sera.

    ID: 1465815

    Description: epitope description:CTLTTSPRLPVF antigen name:MOS host organism:Oryctolagus cuniculus

    Publication: 2994296;

  2. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465819

    Description: epitope description:TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVK antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide ...

    Publication: 7045684;

  3. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465831

    Description: epitope description:NYGGETQIQRRQHTDV antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 17-32 sera

    Publication: 7045684;

  4. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465839

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 141-160 sera

    Publication: 7045684;

  5. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465882

    Description: epitope description:ELAWGIASDGGALKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  6. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465883

    Description: epitope description:LKHGFKTTTDFKIVFPIVAK antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  7. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465901

    Description: epitope description:CALAATDVGHKKNGAQGTVG antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  8. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465906

    Description: epitope description:SDPDTSFLEGLDLGVDVRTY antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  9. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465910

    Description: epitope description:WTANGDYKSKGDKPVYEPGF antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  10. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465913

    Description: epitope description:IKVELTGNSTLSSDYAQARA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  11. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465916

    Description: epitope description:LDLGVDVRTYMPVHYKVLKA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  12. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465917

    Description: epitope description:MPVHYKVLKALPRADIHFPV antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  13. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465920

    Description: epitope description:QVSFTPDIEGYAELAWGIAS antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

    Publication: 12097401;

  14. Trypanosoma cruzi: immune response and functional heart damage induced in mice by the main linear B-cell epitope of parasite ribosomal P proteins.

    ID: 1465921

    Description: epitope description:EEEDDD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c

    Publication: 9562426;

  15. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465922

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 7045684;

  16. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465934

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 141-160 sera

    Publication: 7045684;

  17. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465935

    Description: epitope description:RHKQKIVAPVKQTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 200-213 sera

    Publication: 7045684;

  18. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465971

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;

  19. Cysticercosis: towards the design of a diagnostic kit based on synthetic peptides.

    ID: 1465972

    Description: epitope description:GNLLLSCL antigen name:Protective recombinant antigen (UniProt:Q26874) host organism:Homo sapiens

    Publication: 10709780;

  20. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465977

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston