Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784407

    Description: epitope description:IEQAIGRVTPIF antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  2. Antigenic epitopes on beta 2-microglobulin reacting with monoclonal antibodies.

    ID: 1784414

    Description: epitope description:LSQPKIVKWDR antigen name:Beta-2-microglobulin host organism:Mus musculus BALB/cByJ antibody name:BB7.7, RC3.1, F12.7D, L368, BBM.1...

    Publication: 7685045;

  3. Antigenic epitopes on beta 2-microglobulin reacting with monoclonal antibodies.

    ID: 1784415

    Description: epitope description:SKDWSFY antigen name:Beta-2-microglobulin host organism:Mus musculus BALB/cByJ antibody name:BB7.7, F18.6C, BBM.1, F20.2F, RC3.1, ...

    Publication: 7685045;

  4. Antigenic epitopes on beta 2-microglobulin reacting with monoclonal antibodies.

    ID: 1784433

    Description: epitope description:LSQPKIVKWDR antigen name:Beta-2-microglobulin host organism:Mus musculus BALB/cByJ antibody name:F12.7D, BB7.7, F6.7D

    Publication: 7685045;

  5. The specificity of allergic reactions. III. Contact hypersensitivity.

    ID: 1784448

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Cavia porcellus Hartley

    Publication: 13745825;

  6. An antibody directed against a peptide encoded by RNA complementary to mRNA for vasopressin recognizes putative vasopressin receptors.

    ID: 1784450

    Description: epitope description:SSWAVLEVA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2140594;

  7. Characterization of a monoclonal antibody directed against the carboxyl-terminus of human factor XIII. An epitope exposed upon denaturation and conser...

    ID: 1784459

    Description: epitope description:QIQRRPSM antigen name:Coagulation factor XIII A chain host organism:Mus musculus BALB/c antibody name:7A4

    Publication: 7513094;

  8. Characterization of a monoclonal antibody directed against the carboxyl-terminus of human factor XIII. An epitope exposed upon denaturation and conser...

    ID: 1784465

    Description: epitope description:QIQRRPSM antigen name:Coagulation factor XIII A chain host organism:Mus musculus BALB/c antibody name:7A4

    Publication: 7513094;

  9. A heat shock-like protein from the human malaria parasite Plasmodium falciparum induces autoantibodies.

    ID: 1784468

    Description: epitope description:RNSLENYCYGVKSSLEDQKIKEKLQPAEIETCMKTITTILEWLEKNQLA antigen name:Heat shock 70 kDa protein host organism:Mus musculus BALB/c antibod...

    Publication: 2479563;

  10. Mutations within a conserved region of the hepatitis C virus E2 glycoprotein that influence virus-receptor interactions and sensitivity to neutralizin...

    ID: 1784484

    Description: epitope description:N415, N417, G418 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:AP33

    Publication: 20237087;

  11. Impact of quaternary organization on the antigenic structure of the tick-borne encephalitis virus envelope glycoprotein E.

    ID: 1784501

    Description: epitope description:E487 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:A5 (1E9)

    Publication: 19553320;

  12. Prions of ruminants show distinct splenotropisms in an ovine transgenic mouse model.

    ID: 1784518

    Description: epitope description:YEDRYYRE antigen name:Major prion protein host organism:Mus musculus antibody name:Sha31

    Publication: 20436680;

  13. Designed glycopeptides with different beta-turn types as synthetic probes for the detection of autoantibodies as biomarkers of multiple sclerosis.

    ID: 1784522

    Description: epitope description:TPRVERGNHTVFLAPYGWMVK + GLYC(N8) host organism:Homo sapiens

    Publication: 18712857;

  14. An N-glucosylated peptide detecting disease-specific autoantibodies, biomarkers of multiple sclerosis.

    ID: 1784525

    Description: epitope description:KNATGMEVGWYRPPFSRVVHL + GLUC(N2) antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Homo sapiens

    Publication: 16014416;

  15. An N-glucosylated peptide detecting disease-specific autoantibodies, biomarkers of multiple sclerosis.

    ID: 1784534

    Description: epitope description:TPRVERNGHSVFLAPYGWMVK + GLUC(N7) host organism:Homo sapiens

    Publication: 16014416;

  16. An N-glucosylated peptide detecting disease-specific autoantibodies, biomarkers of multiple sclerosis.

    ID: 1784535

    Description: epitope description:TPRVERNGHSVFLAPYGWMVK + GLUC(N7) host organism:Homo sapiens

    Publication: 16014416;

  17. Identification of a linear epitope of interferon-alpha2b recognized by neutralizing monoclonal antibodies.

    ID: 1784543

    Description: epitope description:ETPLMKEDSILAVRKYFQRITLYLKE antigen name:Interferon alpha-2 host organism:Mus musculus BALB/c antibody name:mAb 204

    Publication: 10491153;

  18. The role of three domains in the biological activity of human interferon-alpha.

    ID: 1784589

    Description: epitope description:NVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIM antigen name:Interferon alpha-21 host organism:Mus musculus BALB/c antibody name:4F2

    Publication: 2523943;

  19. Naturally processed chromatin peptides reveal a major autoepitope that primes pathogenic T and B cells of lupus.

    ID: 1784611

    Description: epitope description:STDHPKYSDMIVAAIQAEKNR antigen name:Histone H1.0 host organism:Mus musculus BALB/c

    Publication: 11859148;

  20. Presence of heterogeneous thyroid-stimulating antibodies in sera from individual Graves' patients as shown by synthesized thyrotropin receptor peptide...

    ID: 1784255

    Description: epitope description:KNQKKIRGILESLMCNES antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7581943;

  21. Presence of heterogeneous thyroid-stimulating antibodies in sera from individual Graves' patients as shown by synthesized thyrotropin receptor peptide...

    ID: 1784256

    Description: epitope description:VFFEEQEDEIIGFG antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7581943;

  22. Anticardiolipin response in acute infections.

    ID: 1784279

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3742889;

  23. Anticardiolipin response in acute infections.

    ID: 1784281

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3742889;

  24. Anticardiolipin antibodies in unselected autoimmune rheumatic disease patients.

    ID: 1784286

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3497746;

  25. Anticardiolipin antibodies in unselected autoimmune rheumatic disease patients.

    ID: 1784291

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3497746;

  26. Anticardiolipin antibodies in rheumatoid arthritis.

    ID: 1784302

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3664159;

  27. Anticardiolipin antibodies in unselected autoimmune rheumatic disease patients.

    ID: 1784324

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3497746;

  28. Anti-phospholipid antibodies in syphilis and a thrombotic subset of SLE: distinct profiles of epitope specificity.

    ID: 1784340

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2579756;

  29. Characterization of an antigen shared by human thymic epithelium and human T cell leukemia virus p19 Gag protein.

    ID: 1784353

    Description: epitope description:IPP antigen name:Gag polyprotein host organism:Mus musculus BALB/c antibody name:12/1-2

    Publication: 8528727;

  30. The proline-rich region of pneumococcal surface proteins A and C contains surface-accessible epitopes common to all pneumococci and elicits antibody-m...

    ID: 1784357

    Description: epitope description:EKSADQQAEEDYARRSEEEYNRLTQQQ antigen name:UniProt:Q97T39 host organism:Mus musculus CBA

    Publication: 20194601;

  31. The proline-rich region of pneumococcal surface proteins A and C contains surface-accessible epitopes common to all pneumococci and elicits antibody-m...

    ID: 1784360

    Description: epitope description:PKPEQ antigen name:UniProt:Q97T39 host organism:Mus musculus CBA antibody name:PR-5C4.7

    Publication: 20194601;

  32. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784364

    Description: epitope description:KCSRLYTACVY + ACET(K1) antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  33. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784366

    Description: epitope description:LRYSTGTVSG antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  34. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784367

    Description: epitope description:PFMLAQFDG antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  35. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784368

    Description: epitope description:IEQAIGRVTPIF antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  36. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784372

    Description: epitope description:LLCEDGCLAL antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  37. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784375

    Description: epitope description:LTSADYVFQESYSSKKLCTLAIHA antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  38. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784379

    Description: epitope description:MDIPPPTGPT + NLeu(M1) antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  39. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784387

    Description: epitope description:LLCEDGCLAL antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  40. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784394

    Description: epitope description:MDIPPPTGPT + NLeu(M1) antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  41. Production and characterization of human renin antibodies prepared with synthetic immunogens.

    ID: 1784397

    Description: epitope description:LRYSTGTVSG antigen name:Renin host organism:Oryctolagus cuniculus

    Publication: 2450977;

  42. Saga of a sperm fertility biomarker.

    ID: 1783834

    Description: epitope description:VKEILKEQENRKGLI antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  43. Saga of a sperm fertility biomarker.

    ID: 1783837

    Description: epitope description:EQENRKGLIAAICAG antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  44. Saga of a sperm fertility biomarker.

    ID: 1783847

    Description: epitope description:TSHPLAKDKMMNGSH antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  45. Saga of a sperm fertility biomarker.

    ID: 1783853

    Description: epitope description:SESRVEKDGLILTSR antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  46. Saga of a sperm fertility biomarker.

    ID: 1783860

    Description: epitope description:GPGTSFEFALAIVEA antigen name:Protein deglycase DJ-1 host organism:Mus musculus

    Publication: 18215478;

  47. Presence of heterogeneous thyroid-stimulating antibodies in sera from individual Graves' patients as shown by synthesized thyrotropin receptor peptide...

    ID: 1783909

    Description: epitope description:TSVQGYAFNGTKLDAVYLNKNKYL antigen name:TSHR protein host organism:Homo sapiens

    Publication: 7581943;

  48. Presence of heterogeneous thyroid-stimulating antibodies in sera from individual Graves' patients as shown by synthesized thyrotropin receptor peptide...

    ID: 1783921

    Description: epitope description:CGDSEDMVCTPKSDEFNPCEDI antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7581943;

  49. Anticardiolipin response in acute infections.

    ID: 1783934

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3742889;

  50. Characterization of a highly immunogenic Mycoplasma hyopneumoniae lipoprotein Mhp366 identified by peptide-spot array.

    ID: 1783946

    Description: epitope description:LNLPGISFELYKTSL antigen name:Other Mycoplasma hyopneumoniae protein host organism:Sus scrofa

    Publication: 19913364;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston