Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1494159

    Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  2. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494163

    Description: epitope description:ACVAGDSSTKNLIYTSTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-...

    Publication: 11882995;

  3. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494168

    Description: epitope description:ACGASNSSTKNLIKNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  4. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494169

    Description: epitope description:ACGASNSSTKNLIKNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-...

    Publication: 11882995;

  5. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494184

    Description: epitope description:SSTKNLIYTSTLCELNVTGF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  6. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494187

    Description: epitope description:SSTKNLIYNLTLCELNVTGFQQ antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-7, 12, 1...

    Publication: 11882995;

  7. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494188

    Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  8. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494189

    Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-18, 159-19, B6501 A4, ...

    Publication: 11882995;

  9. Bovine immune response to inoculation with Neospora caninum surface antigen SRS2 lipopeptides mimics immune response to infection with live parasites.

    ID: 1494272

    Description: epitope description:EWVTGTLQQGIKITIPDEH antigen name:SRS domain-containing protein host organism:Bos taurus Holstein-Friesian

    Publication: 18305105;

  10. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494305

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus C57BL/6 X BALB/c antibody name:anti-SV40 T-ag

    Publication: 7516272;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston