Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494308

    Description: epitope description:FEDVKGTGGESRDLPSGQG antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus C57BL/6 X BALB/c antibody name:a...

    Publication: 7516272;

  2. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494310

    Description: epitope description:CRGFTSFKKPPTPPPEPET host organism:Mus musculus BALB/c antibody name:Pab 405, Pab 101

    Publication: 7516272;

  3. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494324

    Description: epitope description:CRGFTSFKKPPTPPPEPET host organism:Mus musculus BALB/c

    Publication: 7516272;

  4. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494339

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

    Publication: 7523865;

  5. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494344

    Description: epitope description:FEDVKGTGGESRDLPSGQG antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c

    Publication: 7523865;

  6. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494348

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

    Publication: 7523865;

  7. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494349

    Description: epitope description:MGVFNYETETTSVIPAARLFKAFI antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  8. Human immune responses to synthetic peptides from the Epstein-Barr nuclear antigen.

    ID: 1494366

    Description: epitope description:IHSDEGPGTGPGNGLGE antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 2981091;

  9. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494371

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  10. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494374

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

    Publication: 7523865;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston