Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494375

    Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  2. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494378

    Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  3. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494383

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  4. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494385

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  5. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494387

    Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  6. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494390

    Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  7. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494391

    Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  8. The latex allergen hev B 5 is an antigen with repetitive murine B-cell epitopes.

    ID: 1494405

    Description: epitope description:PAEGEK antigen name:Hev b 5 host organism:Mus musculus BALB/c antibody name:3G3, 6A10, 6F6

    Publication: 15241001;

  9. Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

    ID: 1494408

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11578688;

  10. Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

    ID: 1494409

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11578688;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston