Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Generation of monoclonal antibodies against human prion proteins in PrP0/0 mice.

    ID: 1494410

    Description: epitope description:RYPGQGSPGGNRYPPQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mab 4F2

    Publication: 8972487;

  2. A conjugate vaccine composed of a heat shock protein 60 T-cell epitope peptide (p458) and Neisseria meningitidis type B capsular polysaccharide.

    ID: 1494413

    Description: epitope description:NEDQKIGIEIIKRALKI antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c

    Publication: 16843573;

  3. Exploring computational lead optimisation with affinity constants obtained by surface plasmon resonance for the interaction of PorA epitope peptides w...

    ID: 1494434

    Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN12H2

    Publication: 11786227;

  4. A hypoallergenic vaccine obtained by tail-to-head restructuring of timothy grass pollen profilin, Phl p 12, for the treatment of cross-sensitization t...

    ID: 1494439

    Description: epitope description:MKDFDEPGHLAPTGMFVAGAKYMVIQG antigen name:Phl p 12 host organism:Mus musculus BALB/c

    Publication: 18025208;

  5. Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

    ID: 1494464

    Description: epitope description:RYHNTVTKTIETHTDNIETNMDENLRIPVTAEVGSGYFKM antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108D2, P111B10

    Publication: 18538134;

  6. Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

    ID: 1494468

    Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

    Publication: 18538134;

  7. Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

    ID: 1494469

    Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

    Publication: 18538134;

  8. Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

    ID: 1494479

    Description: epitope description:E29 antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 14764736;

  9. Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

    ID: 1494482

    Description: epitope description:Q38 antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 14764736;

  10. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494509

    Description: epitope description:VSVAGTVEGTNQDISLKFFE antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston