Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493898

Description: epitope description:YASSGIGP antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493904

Description: epitope description:RVMYASSG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493906

Description: epitope description:KMVQVVYD antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493909

Description: epitope description:TGATVSSQ antigen name:UniProt:H6MQD5 host organism:Homo sapiens

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493912

Description: epitope description:FRELADAL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493913

Description: epitope description:FRELADAL antigen name:UniProt:H6MQD5 host organism:Homo sapiens

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493915

Description: epitope description:EKAFREL antigen name:UniProt:H6MQD5 host organism:Homo sapiens

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493920

Description: epitope description:VMYASSG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493925

Description: epitope description:YHRVMYAS antigen name:UniProt:H6MQD5 host organism:Homo sapiens

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493926

Description: epitope description:ADYHRVMY antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

ID: 1493932

Description: epitope description:VQVVYDYQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

Generation of rubella virus-neutralising antibodies by vaccination with synthetic peptides.

ID: 1493935

Description: epitope description:HGPDWASP antigen name:Structural polyprotein host organism:Mus musculus BALB/c

Generation of rubella virus-neutralising antibodies by vaccination with synthetic peptides.

ID: 1493937

Description: epitope description:AHTTSDPWHPPG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

Immunogenicity of genetically engineered glutathione S-transferase fusion proteins containing a T-cell epitope from diphtheria toxin.

ID: 1493961

Description: epitope description:NLFQVVHWSYNRPAYSPG antigen name:Diphtheria toxin (UniProt:Q6NK15) host organism:Oryctolagus cuniculus

A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

ID: 1493965

Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

Mimotopes identify conformational B-cell epitopes on the two major house dust mite allergens Der p 1 and Der p 2.

ID: 1493974

Description: epitope description:DMFQIGKYG host organism:Homo sapiens antibody name:anti-Der p 1

Mimotopes identify conformational B-cell epitopes on the two major house dust mite allergens Der p 1 and Der p 2.

ID: 1493979

Description: epitope description:KGTTGVRNT host organism:Homo sapiens

Mimotopes identify conformational B-cell epitopes on the two major house dust mite allergens Der p 1 and Der p 2.

ID: 1493987

Description: epitope description:SWWNLPQIG host organism:Homo sapiens

The immunogenicity of a conformationally restricted peptide mimetic of meningococcal lipooligosaccharide.

ID: 1494001

Description: epitope description:ACNTIGGYECGGGS host organism:Mus musculus C3H antibody name:anti-C22

Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

ID: 1494010

Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

ID: 1494015

Description: epitope description:EIEDTEGLKEVIN antigen name:Protective antigen host organism:Mus musculus BALB/c

Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

ID: 1494027

Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

ID: 1494028

Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

ID: 1494029

Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

ID: 1494039

Description: epitope description:KKRFGPRLRDKDLIK antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

ID: 1494048

Description: epitope description:KKKMKIVVTDDAKKRYKIRLQRFR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

ID: 1494051

Description: epitope description:SENGD antigen name:Protective antigen host organism:Mus musculus BALB/c

Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

ID: 1494052

Description: epitope description:SENGD antigen name:Protective antigen host organism:Mus musculus C57BL/6

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494069

Description: epitope description:VVADHGMFTKYN antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494076

Description: epitope description:VHEIVNTLNGFY antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494081

Description: epitope description:NILISLTDLEIW antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494091

Description: epitope description:FGEWRERVLLNR antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494111

Description: epitope description:VTMAHELGHNLG antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494112

Description: epitope description:AHELGHNLGMKH antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494117

Description: epitope description:HCHCSASFCIMP antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494119

Description: epitope description:SFCIMPPSISEG antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

ID: 1494127

Description: epitope description:YQMFLTKRKPQC antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494137

Description: epitope description:AVAADNSSTKNLTSNLTLCELNVTGFQQHF host organism:Mus musculus BALB/c antibody name:159-7, 12, 18, 19, H12

A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

ID: 1494156

Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

ID: 1494157

Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

ID: 1494159

Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494163

Description: epitope description:ACVAGDSSTKNLIYTSTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-...

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494168

Description: epitope description:ACGASNSSTKNLIKNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494169

Description: epitope description:ACGASNSSTKNLIKNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-...

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494184

Description: epitope description:SSTKNLIYTSTLCELNVTGF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494187

Description: epitope description:SSTKNLIYNLTLCELNVTGFQQ antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-7, 12, 1...

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494188

Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

ID: 1494189

Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-18, 159-19, B6501 A4, ...

Bovine immune response to inoculation with Neospora caninum surface antigen SRS2 lipopeptides mimics immune response to infection with live parasites.

ID: 1494272

Description: epitope description:EWVTGTLQQGIKITIPDEH antigen name:SRS domain-containing protein host organism:Bos taurus Holstein-Friesian

Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

ID: 1494305

Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus C57BL/6 X BALB/c antibody name:anti-SV40 T-ag

Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

ID: 1494308

Description: epitope description:FEDVKGTGGESRDLPSGQG antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus C57BL/6 X BALB/c antibody name:a...

Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

ID: 1494310

Description: epitope description:CRGFTSFKKPPTPPPEPET host organism:Mus musculus BALB/c antibody name:Pab 405, Pab 101

Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

ID: 1494324

Description: epitope description:CRGFTSFKKPPTPPPEPET host organism:Mus musculus BALB/c

SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

ID: 1494339

Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

ID: 1494344

Description: epitope description:FEDVKGTGGESRDLPSGQG antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c

SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

ID: 1494348

Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494349

Description: epitope description:MGVFNYETETTSVIPAARLFKAFI antigen name:Bet v 1 host organism:Homo sapiens

Human immune responses to synthetic peptides from the Epstein-Barr nuclear antigen.

ID: 1494366

Description: epitope description:IHSDEGPGTGPGNGLGE antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494371

Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Homo sapiens

SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

ID: 1494374

Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494375

Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494378

Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494383

Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494385

Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494387

Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494390

Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494391

Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

The latex allergen hev B 5 is an antigen with repetitive murine B-cell epitopes.

ID: 1494405

Description: epitope description:PAEGEK antigen name:Hev b 5 host organism:Mus musculus BALB/c antibody name:3G3, 6A10, 6F6

Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

ID: 1494408

Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

ID: 1494409

Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

Generation of monoclonal antibodies against human prion proteins in PrP0/0 mice.

ID: 1494410

Description: epitope description:RYPGQGSPGGNRYPPQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mab 4F2

A conjugate vaccine composed of a heat shock protein 60 T-cell epitope peptide (p458) and Neisseria meningitidis type B capsular polysaccharide.

ID: 1494413

Description: epitope description:NEDQKIGIEIIKRALKI antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c

Exploring computational lead optimisation with affinity constants obtained by surface plasmon resonance for the interaction of PorA epitope peptides w...

ID: 1494434

Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN12H2

A hypoallergenic vaccine obtained by tail-to-head restructuring of timothy grass pollen profilin, Phl p 12, for the treatment of cross-sensitization t...

ID: 1494439

Description: epitope description:MKDFDEPGHLAPTGMFVAGAKYMVIQG antigen name:Phl p 12 host organism:Mus musculus BALB/c

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

ID: 1494464

Description: epitope description:RYHNTVTKTIETHTDNIETNMDENLRIPVTAEVGSGYFKM antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108D2, P111B10

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

ID: 1494468

Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

ID: 1494469

Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

ID: 1494479

Description: epitope description:E29 antigen name:Hev b 6 host organism:Homo sapiens

Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

ID: 1494482

Description: epitope description:Q38 antigen name:Hev b 6 host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494509

Description: epitope description:VSVAGTVEGTNQDISLKFFE antigen name:Streptokinase host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494512

Description: epitope description:MPHKLEKADLLKAIQEQLIA antigen name:Streptokinase host organism:Homo sapiens

Selection of an immunogenic peptide mimic of the capsular polysaccharide of Neisseria meningitidis serogroup A using a peptide display library.

ID: 1494567

Description: epitope description:GHREAFLPPWVFXFL host organism:Mus musculus BALB/c antibody name:9C10

Selection of an immunogenic peptide mimic of the capsular polysaccharide of Neisseria meningitidis serogroup A using a peptide display library.

ID: 1494568

Description: epitope description:GNRPVRPQVYFSASS host organism:Mus musculus BALB/c antibody name:9C10

Selection of an immunogenic peptide mimic of the capsular polysaccharide of Neisseria meningitidis serogroup A using a peptide display library.

ID: 1494570

Description: epitope description:SGFVAGKGFRLDFGS host organism:Mus musculus BALB/c antibody name:9C10

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494572

Description: epitope description:QPVQEFLLSGHVRVRPYKEK antigen name:Streptokinase host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494573

Description: epitope description:HVRVRPYKEKPIQNQAKSVD antigen name:Streptokinase host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494576

Description: epitope description:NPDDDFRPGLKDTKLLKTLA antigen name:Streptokinase host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494579

Description: epitope description:LAQAQSILNKTHPGYTIYER antigen name:Streptokinase host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494590

Description: epitope description:VDVNTNELLKSEQLLTASER antigen name:Streptokinase host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494591

Description: epitope description:SEQLLTASERNLDFRDLYDP antigen name:Streptokinase host organism:Homo sapiens

Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

ID: 1491834

Description: epitope description:CVHPDKDSC host organism:Mus musculus BALB/c antibody name:F5

Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

ID: 1491840

Description: epitope description:CDPPIDLDC host organism:Mus musculus antibody name:LT1

Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

ID: 1491841

Description: epitope description:CDPQPDFSC host organism:Mus musculus antibody name:LT1

Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

ID: 1491895

Description: epitope description:IRAWVAWRAHCQNRD antigen name:Lysozyme C-2 host organism:Mus musculus BALB/c

Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

ID: 1491896

Description: epitope description:NEDQKIGIEIIKRALKI antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c antibody name:anti - PS4...

Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

ID: 1491900

Description: epitope description:FNNFTVSFWLRVPKVSASHLE antigen name:Tetanus toxin host organism:Mus musculus BALB/c antibody name:anti - PS4 Ab

Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

ID: 1491922

Description: epitope description:TAGPNEYVYYKVYATYRKYQ antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

ID: 1491957

Description: epitope description:TNSNSNLSDGLYVIDKGDGG host organism:Oryctolagus cuniculus antibody name:anti-CPE

Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

ID: 1491963

Description: epitope description:YRKYQAIRISHGNISDDGSI antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

ID: 1491966

Description: epitope description:LVLNRLKVGLQVVAVKAPGF antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c antibody name:Ab to t...