Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

ID: 1465980

Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

ID: 1465981

Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

ID: 1465993

Description: epitope description:MPSFLKKILKLRGRRQEEESRSRMLSDSSM antigen name:Protein C' host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

ID: 1465995

Description: epitope description:YVKSLSKCKTDQEVKAVMELVEEDIESLTN antigen name:Phosphoprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466001

Description: epitope description:FFRSTPEDLERAEK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466020

Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466022

Description: epitope description:YNRNAVPNLRGDLQV antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466040

Description: epitope description:SEKSKCEENTMFQPY antigen name:envelope polyprotein host organism:Equus caballus

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466042

Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466044

Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466046

Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466047

Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Assessment of protective immune responses against hydatid disease in sheep by immunization with synthetic peptide antigens.

ID: 1466050

Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries Merino X Border Leiscester

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466052

Description: epitope description:NEYIEKANITTDDK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466060

Description: epitope description:ERTLPGQKACDDVN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466063

Description: epitope description:GPYAGPLERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466067

Description: epitope description:PYCYNNDSKNSMAESKEAR antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466075

Description: epitope description:WGSFPGCRPFQNYFSYET antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466076

Description: epitope description:WGSFPGCRPFQNYFSYET antigen name:envelope polyprotein host organism:Equus caballus

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466085

Description: epitope description:PLERQKPLKVRAKL antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera