Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

    ID: 1409009

    Description: epitope description:DSNFSVKTEMLGNEI antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

    Publication: 1376768;

  2. Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

    ID: 1409035

    Description: epitope description:PLSLPTSAQDSNFSV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

    Publication: 1376768;

  3. Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

    ID: 1409036

    Description: epitope description:LPTSAQDSNFSVKTE antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

    Publication: 1376768;

  4. Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

    ID: 1409037

    Description: epitope description:SAQDSNFSVKTEMLG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

    Publication: 1376768;

  5. Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

    ID: 1409039

    Description: epitope description:FSVKTEMLGNEIDIE antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

    Publication: 1376768;

  6. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409091

    Description: epitope description:GFLGPLL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  7. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409104

    Description: epitope description:FLLTRIL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  8. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409111

    Description: epitope description:TIPQSLD antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  9. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409113

    Description: epitope description:PQSLDSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  10. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409114

    Description: epitope description:QSLDSWW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  11. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409123

    Description: epitope description:LNFLGGS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  12. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409124

    Description: epitope description:NFLGGSP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  13. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409131

    Description: epitope description:VCLGQNS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  14. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409140

    Description: epitope description:PTSNHSP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  15. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409142

    Description: epitope description:SNHSPTS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  16. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409143

    Description: epitope description:NHSPTSC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  17. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409144

    Description: epitope description:HSPTSCP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  18. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409147

    Description: epitope description:TSCPPIC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  19. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409157

    Description: epitope description:RWMCLRR antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  20. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409191

    Description: epitope description:VCPLIPG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  21. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409195

    Description: epitope description:IPGSTTT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  22. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410218

    Description: epitope description:IVSFLSEVISLAGSDANIPAIQNLAK antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  23. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410220

    Description: epitope description:AHINFDGPTETAWTLALDTTYAMLFSAMDS antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  24. Molecular evolution of antibody cross-reactivity for two subtypes of type A botulinum neurotoxin.

    ID: 1410242

    Description: epitope description:F953, R1064 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus antibody name:AR2

    Publication: 17173035;

  25. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410257

    Description: epitope description:IVSFLSEVISLAGSDANIPAIQNLAK antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  26. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410260

    Description: epitope description:KAYPDIMAKFPQFAGKDLDSIKDSAAF antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  27. Crystal structure of glycoprotein B from herpes simplex virus 1.

    ID: 1410449

    Description: epitope description:R304 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1375

    Publication: 16840698;

  28. Crystal structure of glycoprotein B from herpes simplex virus 1.

    ID: 1410450

    Description: epitope description:E305 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:B4

    Publication: 16840698;

  29. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410460

    Description: epitope description:ANANRDTDRDGIPDE antigen name:Other Clostridium botulinum protein host organism:Oryctolagus cuniculus

    Publication: 10899856;

  30. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410461

    Description: epitope description:RLSGVFLIELDKLII antigen name:Other Clostridium botulinum protein host organism:Oryctolagus cuniculus

    Publication: 10899856;

  31. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410464

    Description: epitope description:FKENISSINIINDTNFGVQSMTGLSNRSKGQDGIYRAATTAFSFKSKELKYPEGRYRMRFVIQSYEPFTCNFKLFNNLIYSSSFDKGYYDEFFYFYYNGSKSFFNISCDIINSINRLSGVFLIELDKLII...

    Publication: 10899856;

  32. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410481

    Description: epitope description:MLVSKFENSVKNSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIEQLMSENQLLK...

    Publication: 10899856;

  33. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410483

    Description: epitope description:MLVSKFENSVKNSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIEQLMSENQLLK...

    Publication: 10899856;

  34. Characterization of murine monoclonal and murine, rabbit, and human polyclonal antibodies against chlamydial lipopolysaccharide.

    ID: 1410594

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 2294050;

  35. Treatment of cat allergy with T-cell reactive peptides.

    ID: 1410604

    Description: epitope description:KRDVDLFLTGTPDEYVEQVAQYKALPV antigen name:Fel d 1 host organism:Homo sapiens

    Publication: 8970345;

  36. Characterization of murine monoclonal and murine, rabbit, and human polyclonal antibodies against chlamydial lipopolysaccharide.

    ID: 1410605

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c

    Publication: 2294050;

  37. Structural and functional complexity of the humoral response against the Trypanosoma cruzi ribosomal P2 beta protein in patients with chronic Chagas' ...

    ID: 1410811

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 15147356;

  38. Structural and functional complexity of the humoral response against the Trypanosoma cruzi ribosomal P2 beta protein in patients with chronic Chagas' ...

    ID: 1410812

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 15147356;

  39. Treatment of cat allergy with T-cell reactive peptides.

    ID: 1410814

    Description: epitope description:KALPVVLENARILKNCVDAKMTEEDKE antigen name:Fel d 1 host organism:Homo sapiens

    Publication: 8970345;

  40. Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

    ID: 1411228

    Description: epitope description:SRLGRSSAWV host organism:Homo sapiens antibody name:anti-Phl p 5

    Publication: 15577826;

  41. Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

    ID: 1411243

    Description: epitope description:ERAGAMERAN host organism:Homo sapiens antibody name:anti-Phl p 5

    Publication: 15577826;

  42. Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

    ID: 1411244

    Description: epitope description:RSVSKEEPGM host organism:Homo sapiens antibody name:anti-Phl p 5

    Publication: 15577826;

  43. Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

    ID: 1411251

    Description: epitope description:PSTPGSRQNM host organism:Homo sapiens antibody name:Phl p 5a-specific IgE

    Publication: 15577826;

  44. Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

    ID: 1411260

    Description: epitope description:VQDLMKSSGV host organism:Homo sapiens antibody name:Phl p 5a-specific IgE

    Publication: 15577826;

  45. A major wheat allergen has a Gln-Gln-Gln-Pro-Pro motif identified as an IgE-binding epitope.

    ID: 1411265

    Description: epitope description:QQQPP antigen name:Uncharacterized protein (UniProt:Q8W3V4) host organism:Homo sapiens

    Publication: 8604979;

  46. A major wheat allergen has a Gln-Gln-Gln-Pro-Pro motif identified as an IgE-binding epitope.

    ID: 1411267

    Description: epitope description:QQQPP antigen name:Uncharacterized protein (UniProt:Q8W3V4) host organism:Homo sapiens

    Publication: 8604979;

  47. Identification and fine mapping of IgG and IgE epitopes in ovomucoid.

    ID: 1411428

    Description: epitope description:SSYAN antigen name:Gal d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 11944924;

  48. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1411660

    Description: epitope description:GSIGAASMEFCF antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  49. Identification of tropomyosin as the major shrimp allergen and characterization of its IgE-binding epitopes.

    ID: 1411661

    Description: epitope description:MQQLENDLDQVQESLLK antigen name:Fenneropenaeus indicus protein host organism:Homo sapiens

    Publication: 7693809;

  50. Identification of tropomyosin as the major shrimp allergen and characterization of its IgE-binding epitopes.

    ID: 1411662

    Description: epitope description:MQQLENDLDQVQESLLK antigen name:Fenneropenaeus indicus protein host organism:Homo sapiens

    Publication: 7693809;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston