Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1276137

    Description: epitope description:KESQAYYDGRR antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mAbs 39, 147

    Publication: 15003861;

  2. Hepatitis E virus: identification of type-common epitopes.

    ID: 1276200

    Description: epitope description:ANPPDHSAPLGVTRPSAPPLPHVVDLPQLGPRR antigen name:Protein ORF3 host organism:Homo sapiens antibody name:F387-C

    Publication: 1717709;

  3. Analysis of antigenicity of Clostridium botulinum type C1 and D toxins by polyclonal and monoclonal antibodies.

    ID: 1276215

    Description: epitope description:MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFT...

    Publication: 6198281;

  4. Analysis of antigenicity of Clostridium botulinum type C1 and D toxins by polyclonal and monoclonal antibodies.

    ID: 1276216

    Description: epitope description:MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFT...

    Publication: 6198281;

  5. Expression and immunoreactivity of HCV/HBV epitopes.

    ID: 1276317

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens antibody name:anti-HBs

    Publication: 16425413;

  6. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276322

    Description: epitope description:VNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELK anti...

    Publication: 9014296;

  7. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276344

    Description: epitope description:KPAIIPDREVLYREFDEMEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  8. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276345

    Description: epitope description:LYREFDEMEECSQHLPYIEQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  9. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276349

    Description: epitope description:AFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  10. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276354

    Description: epitope description:AVLTSMLTDPSHITAETAKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  11. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276368

    Description: epitope description:DVESYSSMPPLEGEPGDPDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  12. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276369

    Description: epitope description:YSSMPPLEGEPGDPDLSDGS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  13. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276371

    Description: epitope description:AAEESKLPINPLSNSLLRH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  14. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276376

    Description: epitope description:KATAACRAAKLQDCTMLVN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  15. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276387

    Description: epitope description:SASQLSAPSLKATCTTHHDS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  16. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276392

    Description: epitope description:EEACKLTPPHSAKSKFGYG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  17. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276402

    Description: epitope description:EVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTI...

    Publication: 9014296;

  18. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276410

    Description: epitope description:ITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEK...

    Publication: 9014296;

  19. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276412

    Description: epitope description:ITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEK...

    Publication: 9014296;

  20. Detection of prion epitopes on PrP and PrP of transmissible spongiform encephalopathies using specific monoclonal antibodies to PrP.

    ID: 1276418

    Description: epitope description:KTNMKHMAGA antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:2E7, 7C1, 6G4, 3F4

    Publication: 16266315;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston