Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1492031

    Description: epitope description:KGDGWILGEPSVVSSQILNL host organism:Oryctolagus cuniculus

    Publication: 7535106;

  2. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492047

    Description: epitope description:R279 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:57, 66, 380, 42

    Publication: 1849969;

  3. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492056

    Description: epitope description:PVMHPHGAPPNHRPWQMKDLQAIKQEVSQA antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  4. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492060

    Description: epitope description:LDLLFWEQGGLCKALQEQCRFP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  5. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492063

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKPGNPAQPVCS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal flui...

    Publication: 8741079;

  6. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492075

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  7. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492077

    Description: epitope description:R279, K461 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:63, 50

    Publication: 1849969;

  8. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492081

    Description: epitope description:P451 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:37

    Publication: 1849969;

  9. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492084

    Description: epitope description:CFDPQIQAIVSSPCHN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  10. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492086

    Description: epitope description:S184 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:68, 41

    Publication: 1849969;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston