Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492536

    Description: epitope description:AGKNQSQKKKK antigen name:Nucleoprotein host organism:Mus musculus antibody name:138.22

    Publication: 9875321;

  2. Presence of autologous neutralizing antibodies against cytomegalovirus (CMV) in serum of human immunodeficiency virus type 1-infected patients sheddin...

    ID: 1492542

    Description: epitope description:AGTQTPVNGNSPWAPTAPLPGDMNPANWPR antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 8169399;

  3. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492544

    Description: epitope description:QLCQLL antigen name:Nucleoprotein host organism:Mus musculus antibody name:125.1, 126.9

    Publication: 9875321;

  4. Rotavirus neutralizing protein VP7: antigenic determinants investigated by sequence analysis and peptide synthesis.

    ID: 1492552

    Description: epitope description:ATEINDNSWKDTLS antigen name:Outer capsid glycoprotein VP7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2582147;

  5. Rotavirus neutralizing protein VP7: antigenic determinants investigated by sequence analysis and peptide synthesis.

    ID: 1492557

    Description: epitope description:LTTDATTFEEVATAEKLV antigen name:Outer capsid glycoprotein VP7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2582147;

  6. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492559

    Description: epitope description:QLCQLL antigen name:Nucleoprotein host organism:Mus musculus antibody name:125.1, 126.9, NS95, NS99

    Publication: 9875321;

  7. Rotavirus neutralizing protein VP7: antigenic determinants investigated by sequence analysis and peptide synthesis.

    ID: 1492561

    Description: epitope description:RNCKKLGPRENVA antigen name:Outer capsid glycoprotein VP7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2582147;

  8. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492580

    Description: epitope description:P51, E52, K53, P54, H55, F56, P57, L58, A59, A60, E61, D62, D63, I64, R65, H66, H67, I80, Q81, T82, A83, F84, N85, Q86, G87, A88, ...

    Publication: 9875321;

  9. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492616

    Description: epitope description:VKRGGAFALC antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  10. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492628

    Description: epitope description:KRGGAFALCL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston