Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466087

Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466088

Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466089

Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466091

Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466093

Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466096

Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466112

Description: epitope description:REITFIYKSSCTDSDH antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466113

Description: epitope description:TDSDHCQEYQCKKVNLNSSDS antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466115

Description: epitope description:SSDSSNSVRVEDVTNTAEYWGFKWLECNQT antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466121

Description: epitope description:KGCNETWARVKRCPIDILYGIHPIRLCVQ antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466124

Description: epitope description:RLCVQPPFFLVQEKGIADTSR antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466126

Description: epitope description:ADTSRIGNCGPTIFLGVLED antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466127

Description: epitope description:LGVLEDNKGVVRGDYTAC antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466131

Description: epitope description:TGIYQVPIFYTCTFTNITSCNSKPII antigen name:envelope polyprotein host organism:Equus caballus

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466155

Description: epitope description:VYAEINVKALKLSLESNGGA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466159

Description: epitope description:TPSKYGLGGDILFGWERTRE antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466175

Description: epitope description:ELAWGIASDGGALKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

ID: 1466176

Description: epitope description:FKIVFPIVAKKDFKYRGEGN antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466192

Description: epitope description:RPKHPIKHQGLPQEVLNENL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466200

Description: epitope description:LNENLLRFFVAPFPQVFGKE antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein