Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Depressed primary in vitro antibody response in rheumatoid arthritis.

    ID: 1795672

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Homo sapiens

    Publication: 159147;

  2. A monoclonal autoantibody that promotes central nervous system remyelination in a model of multiple sclerosis is a natural autoantibody encoded by ger...

    ID: 1795698

    Description: epitope description:fluorescein host organism:Mus musculus SJL antibody name:SCH94.03

    Publication: 7868912;

  3. A monoclonal autoantibody that promotes central nervous system remyelination in a model of multiple sclerosis is a natural autoantibody encoded by ger...

    ID: 1795699

    Description: epitope description:fluorescein host organism:Mus musculus SJL antibody name:SCH94.03

    Publication: 7868912;

  4. Mechanism for increased immunogenicity of vaccines that form in vivo immune complexes with the natural anti-Gal antibody.

    ID: 1795747

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus C57BL/6 alpha1,3GT null

    Publication: 19428921;

  5. Characterization of a cashew allergen, 11S globulin (Ana o 2), conformational epitope.

    ID: 1795752

    Description: epitope description:EESEDEKRRWGQRDN antigen name:Ana o 2 host organism:Mus musculus BALB/c antibody name:1F5

    Publication: 20362336;

  6. Structural characterization of the epitope recognized by the new anti-Fy6 monoclonal antibody NaM 185-2C3.

    ID: 1795785

    Description: epitope description:FEDVW antigen name:Atypical chemokine receptor 1 host organism:Mus musculus BALB/c antibody name:NaM185-2C3

    Publication: 12164140;

  7. Degenerate interfaces in antigen-antibody complexes.

    ID: 1795807

    Description: epitope description:E53, N64, T65, D66, S68, D70, Q75, I76, N77, R79, W80, W81, R91, L93, I116, D119, N121, N124, A125, W126, V127, R130, K134 antigen...

    Publication: 11676532;

  8. A 13-mer peptide straddling the leucine33/proline33 polymorphism in glycoprotein IIIa does not define the PLA1 epitope.

    ID: 1795826

    Description: epitope description:SDEALPLGSPRCD antigen name:Integrin beta-3 host organism:Mus musculus

    Publication: 1708295;

  9. A 13-mer peptide straddling the leucine33/proline33 polymorphism in glycoprotein IIIa does not define the PLA1 epitope.

    ID: 1795827

    Description: epitope description:SDEALPPGSPRCD antigen name:Integrin beta-3 host organism:Mus musculus

    Publication: 1708295;

  10. Distribution of the alphaGal- and the non-alphaGal T-antigens in the pig kidney: potential targets for rejection in pig-to-man xenotransplantation.

    ID: 1795837

    Description: epitope description:beta-D-Galp-(1->3)-D-GalpNAc host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 18301385;

  11. Production and characterization of a peptide specific, anti-major histocompatibility complex class II, monoclonal antibody.

    ID: 1795929

    Description: epitope description:AEYWNSQPEILERTRAELDTVCRHNYEGPETH antigen name:H-2 class II histocompatibility antigen, A beta chain host organism:Cricetulus migra...

    Publication: 1648172;

  12. Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.

    ID: 1795941

    Description: epitope description:I233, D234, K235, S236, E237, G238, R239, F240, H241, V242, L266, K270 antigen name:Beta-2 adrenergic receptor host organism:Mus m...

    Publication: 17952055;

  13. A novel hepatitis B virus variant S 129 (Gln-->Leu): lack of correlation between antigenicity and immunogenicity.

    ID: 1795991

    Description: epitope description:Q129 antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 10534722;

  14. Synthetic galactocerebrosides evoke myelination-inhibiting antibodies.

    ID: 1796006

    Description: epitope description:D-galactose host organism:Oryctolagus cuniculus New Zealand White

    Publication: 831265;

  15. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796016

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  16. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796019

    Description: epitope description:SHQESTKGKSKGKSGKSGS antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  17. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796041

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS + CITR(K9) antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  18. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796050

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS + CITR(K9) antigen name:Other Mus musculus (mouse) protein host organism:Homo sapiens

    Publication: 20488785;

  19. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796056

    Description: epitope description:RYSDLLMAWGQYIDHDIA antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody...

    Publication: 15761037;

  20. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796077

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 15761037;

  21. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796083

    Description: epitope description:EDFESCDSITGMNLEA antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody n...

    Publication: 15761037;

  22. Mapping of the binding specificity for five monoclonal antibodies recognizing 3-deoxy-D-manno-octulosonic acid in bacterial lipopolysaccharides.

    ID: 1796086

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MASM 1

    Publication: 2033255;

  23. Mapping of the binding specificity for five monoclonal antibodies recognizing 3-deoxy-D-manno-octulosonic acid in bacterial lipopolysaccharides.

    ID: 1796088

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MAEC 7

    Publication: 2033255;

  24. Characterization of monoclonal anti-beta2-glycoprotein-I and anti-prothrombin antibody fragments generated by phage display from a patient with primar...

    ID: 1796103

    Description: epitope description:sphingomyelin d18:1 host organism:Homo sapiens antibody name:Beta 1, Beta 2, Prot 1

    Publication: 16330187;

  25. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796108

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 15761037;

  26. Structural characterization of the epitope recognized by the new anti-Fy6 monoclonal antibody NaM 185-2C3.

    ID: 1796120

    Description: epitope description:FEDVW antigen name:Atypical chemokine receptor 1 host organism:Mus musculus BALB/c antibody name:NaM185-2C3

    Publication: 12164140;

  27. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796122

    Description: epitope description:KFP antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-P43

    Publication: 15761037;

  28. Structure of the O-polysaccharide and serological cross-reactivity of the Providencia stuartii O33 lipopolysaccharide containing 4-(N-acetyl-D-aspart-...

    ID: 1796129

    Description: epitope description:P. stuartii O33 O-specific polysaccharide antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15145457;

  29. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796143

    Description: epitope description:TAIASRSV antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens antibody name:TR1.8

    Publication: 15761037;

  30. Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with...

    ID: 1796308

    Description: epitope description:S85, Q86, K87, N88, V89, A90, Q95, T96, N97, Y99, Y102, C136, E137, G138, Y141 antigen name:Ribonuclease pancreatic host organism:...

    Publication: 17888451;

  31. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796358

    Description: epitope description:RLIKQLKSEDNRGGI antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  32. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796365

    Description: epitope description:QNFAVVKRAREERFE antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  33. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796371

    Description: epitope description:YEAGTVEAWDPNHEQ antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  34. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796383

    Description: epitope description:QSRGRNLFSGFDTEL antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  35. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796385

    Description: epitope description:AEAFQVDERLIKQLK antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  36. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796388

    Description: epitope description:SERGSESEEESEDEK antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  37. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796389

    Description: epitope description:RWGQRDNGIEETICT antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  38. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796392

    Description: epitope description:PARADIYTPEVGRLT antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  39. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796397

    Description: epitope description:QVVDNFGNRVFDGEV antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  40. Human major histocompatibility complex class I antigens: residues 61-83 of the HLA-B7 heavy chain specify an alloreactive site.

    ID: 1796405

    Description: epitope description:DRNTQIYKAQAQTDRESLRNLRG antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus

    Publication: 3881768;

  41. Immune response to small intestinal submucosa (surgisis) implant in humans: preliminary observations.

    ID: 1796407

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 17710604;

  42. Characterization of high affinity monoclonal antibodies specific for chlamydial lipopolysaccharide.

    ID: 1796472

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 10642603;

  43. Characterization of high affinity monoclonal antibodies specific for chlamydial lipopolysaccharide.

    ID: 1796473

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 10642603;

  44. Main immunogenic region structure promotes binding of conformation-dependent myasthenia gravis autoantibodies, nicotinic acetylcholine receptor confor...

    ID: 1796477

    Description: epitope description:E22, H23, E24, T25, R26, L27, V28, A29, K30, L31, F32, K33, D34, W80, V81, D82, Y83, N84, L85, K86, W87, N88, P89, D90, D91, Y92, ...

    Publication: 19890000;

  45. Main immunogenic region structure promotes binding of conformation-dependent myasthenia gravis autoantibodies, nicotinic acetylcholine receptor confor...

    ID: 1796479

    Description: epitope description:E22, H23, E24, T25, R26, L27, V28, A29, K30, L31, F32, K33, D34, W80, V81, D82, Y83, N84, L85, K86, W87, N88, P89, D90, D91, Y92, ...

    Publication: 19890000;

  46. Mechanism of dinitrochlorobenzene-induced dermatitis in mice: role of specific antibodies in pathogenesis.

    ID: 1796481

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus BALB/c

    Publication: 19890385;

  47. Mechanism of dinitrochlorobenzene-induced dermatitis in mice: role of specific antibodies in pathogenesis.

    ID: 1796491

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus BALB/c

    Publication: 19890385;

  48. Characterization of a monoclonal antibody specific for lipoteichoic acid from various gram-positive bacteria.

    ID: 1796597

    Description: epitope description:glycerol 1-phosphate antigen name:lipoteichoic acid host organism:Mus musculus BALB/c antibody name:3G6

    Publication: 6083437;

  49. Identification of peptide mimetics of xenoreactive alpha-Gal antigenic epitope by phage display.

    ID: 1796601

    Description: epitope description:FHENWPS host organism:Mus musculus antibody name:anti-B

    Publication: 16630577;

  50. Mercaptobenzothiazole allergenicity-role of the thiol group.

    ID: 1796604

    Description: epitope description:dibenzothiazol-2-yl disulfide host organism:Cavia porcellus Hartley

    Publication: 18568896;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston