Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mercaptobenzothiazole allergenicity-role of the thiol group.

    ID: 1796606

    Description: epitope description:2-methylthio-1,3-benzothiazole host organism:Cavia porcellus Hartley

    Publication: 18568896;

  2. Naturally-occurring human serum antibodies to inner core lipopolysaccharide epitopes of Neisseria meningitidis protect against invasive meningococcal ...

    ID: 1796608

    Description: epitope description:D-Glcp-(1->3)-[alpha-D-GlcpNAc-(1->2)]-6-PEA-L-alpha-D-Hepp-(1->3)-L-alpha-D-Hepp-(1->5)-[alpha-Kdo-(2->4)]-alpha-Kdo antigen name...

    Publication: 18835574;

  3. Fine specificity and isotype expression of anti-PC antibodies in BALB/c, MRL/Mp-lpr/lpr, and -(+)/+ mice at different ages.

    ID: 1796610

    Description: epitope description:phosphocholine host organism:Mus musculus MLR/lpr

    Publication: 2320956;

  4. Human antilipid A monoclonal antibodies bind to human B cells and the i antigen on cord red blood cells.

    ID: 1796623

    Description: epitope description:gentobiose octaacetate host organism:Homo sapiens antibody name:216

    Publication: 7691963;

  5. Human antilipid A monoclonal antibodies bind to human B cells and the i antigen on cord red blood cells.

    ID: 1796625

    Description: epitope description:gentobiose octaacetate host organism:Homo sapiens antibody name:216

    Publication: 7691963;

  6. Human antilipid A monoclonal antibodies bind to human B cells and the i antigen on cord red blood cells.

    ID: 1796627

    Description: epitope description:gentobiose octaacetate host organism:Homo sapiens antibody name:216

    Publication: 7691963;

  7. Fine specificity and isotype expression of anti-PC antibodies in BALB/c, MRL/Mp-lpr/lpr, and -(+)/+ mice at different ages.

    ID: 1796629

    Description: epitope description:phosphocholine host organism:Mus musculus MLR/lpr

    Publication: 2320956;

  8. Fine specificity and isotype expression of anti-PC antibodies in BALB/c, MRL/Mp-lpr/lpr, and -(+)/+ mice at different ages.

    ID: 1796636

    Description: epitope description:p-nitrophenylphosphocholine host organism:Mus musculus MLR/lpr

    Publication: 2320956;

  9. Status of blood group carbohydrate chains in ontogenesis and in oncogenesis.

    ID: 1802694

    Description: epitope description:alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->...

    Publication: 60462;

  10. Peritoneal cavity B cells are precursors of splenic IgM natural antibody-producing cells.

    ID: 1802696

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus C57BL/6 alpha1,3GT null

    Publication: 14607944;

  11. Synthesis of peptide-immunogens corresponding to amino acid sequences from human histocompatibility class II membrane glycoproteins.

    ID: 1802712

    Description: epitope description:RWPEFSKFGGFDPQG host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2354878;

  12. Synthesis of peptide-immunogens corresponding to amino acid sequences from human histocompatibility class II membrane glycoproteins.

    ID: 1802722

    Description: epitope description:FSKFISFD antigen name:HLA class II histocompatibility antigen, DQ alpha 2 chain host organism:Oryctolagus cuniculus New Zealand Wh...

    Publication: 2354878;

  13. HLA-B27 antigenicity: antibodies against the chemically synthesized 63-84 peptide from HLA-B27.1 display alloantigenic specificity and discriminate am...

    ID: 1802781

    Description: epitope description:ETQICKAKAQTDREDLRTLLRY antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Oryctolagus cuniculus a...

    Publication: 2424988;

  14. Administration of GAS914 in an orthotopic pig-to-baboon heart transplantation model.

    ID: 1802804

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio

    Publication: 15693844;

  15. Directed mutagenesis in region 713-720 of human thyroperoxidase assigns 713KFPED717 residues as being involved in the B domain of the discontinuous im...

    ID: 1802805

    Description: epitope description:KFPED antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Mus musculus BALB/c antibody name:mAb 47

    Publication: 15150267;

  16. Directed mutagenesis in region 713-720 of human thyroperoxidase assigns 713KFPED717 residues as being involved in the B domain of the discontinuous im...

    ID: 1802806

    Description: epitope description:P715, D717 antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens antibody name:TR1.9

    Publication: 15150267;

  17. Man, apes, and Old World monkeys differ from other mammals in the expression of alpha-galactosyl epitopes on nucleated cells.

    ID: 1802847

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 2460463;

  18. Man, apes, and Old World monkeys differ from other mammals in the expression of alpha-galactosyl epitopes on nucleated cells.

    ID: 1802848

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 2460463;

  19. Man, apes, and Old World monkeys differ from other mammals in the expression of alpha-galactosyl epitopes on nucleated cells.

    ID: 1802857

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 2460463;

  20. Man, apes, and Old World monkeys differ from other mammals in the expression of alpha-galactosyl epitopes on nucleated cells.

    ID: 1802859

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 2460463;

  21. Man, apes, and Old World monkeys differ from other mammals in the expression of alpha-galactosyl epitopes on nucleated cells.

    ID: 1802861

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 2460463;

  22. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802898

    Description: epitope description:KWEAAREAEQRR antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus antibody nam...

    Publication: 3081631;

  23. Novel amyloid-beta specific scFv and VH antibody fragments from human and mouse phage display antibody libraries.

    ID: 1802903

    Description: epitope description:SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:C 1.27, C...

    Publication: 20451261;

  24. Novel amyloid-beta specific scFv and VH antibody fragments from human and mouse phage display antibody libraries.

    ID: 1802906

    Description: epitope description:SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:C 1.27, C...

    Publication: 20451261;

  25. Crucial epitopes of Wuchereria bancrofti abundant larval transcript recognized in natural infection.

    ID: 1803010

    Description: epitope description:SEGGDEYVTKGEVVETD antigen name:Abundant larval transcript-2 protein host organism:Homo sapiens

    Publication: 20803227;

  26. Crucial epitopes of Wuchereria bancrofti abundant larval transcript recognized in natural infection.

    ID: 1803018

    Description: epitope description:YDQREPQAWCRPNENQSWT antigen name:Abundant larval transcript-2 protein host organism:Homo sapiens

    Publication: 20803227;

  27. Novel amyloid-beta specific scFv and VH antibody fragments from human and mouse phage display antibody libraries.

    ID: 1803054

    Description: epitope description:SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Homo sapiens antibody name:3.15, 3.20. 4.8

    Publication: 20451261;

  28. Monoclonal IgM in two patients with motor neuron disease bind to the carbohydrate antigens Gal(beta 1-3)GalNAc and Gal(beta 1-3)GlcNAc.

    ID: 1803071

    Description: epitope description:beta-D-Galp-(1->3)-beta-D-GalpNAc host organism:Homo sapiens

    Publication: 2457603;

  29. beta-Lactam allergenic determinants: fine structural recognition of a cross-reacting determinant on benzylpenicillin and cephalothin.

    ID: 1803089

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 12569987;

  30. Alloantigenic sites on class I major histocompatibility complex antigens: 61-69 region in the first domain of the H-2Kb molecule induces specific anti...

    ID: 1803090

    Description: epitope description:ERETQKAKG antigen name:H-2 class I histocompatibility antigen, K-B alpha chain host organism:Mus musculus BALB/c antibody name:B8-...

    Publication: 2428867;

  31. Epitope analysis of peanut allergen Ara h1 with human monoclonal IgM antibody 92-2.

    ID: 1803105

    Description: epitope description:QEWGTPGS antigen name:Ara h 1 host organism:Homo sapiens antibody name:92-2

    Publication: 20024620;

  32. Epitope analysis of peanut allergen Ara h1 with human monoclonal IgM antibody 92-2.

    ID: 1803111

    Description: epitope description:QEWGTPGS antigen name:Ara h 1 host organism:Homo sapiens antibody name:92-2

    Publication: 20024620;

  33. beta-Lactam allergenic determinants: fine structural recognition of a cross-reacting determinant on benzylpenicillin and cephalothin.

    ID: 1803176

    Description: epitope description:amoxicilloyl group host organism:Homo sapiens

    Publication: 12569987;

  34. beta-Lactam allergenic determinants: fine structural recognition of a cross-reacting determinant on benzylpenicillin and cephalothin.

    ID: 1803181

    Description: epitope description:amoxicillanyl group host organism:Homo sapiens

    Publication: 12569987;

  35. Localization of neural epitopes that bind to IgM monoclonal autoantibodies (M-proteins) from two patients with motor neuron disease.

    ID: 1803199

    Description: epitope description:beta-D-Galp-(1->3)-D-GlcpNAc host organism:Homo sapiens

    Publication: 2461959;

  36. Localization of neural epitopes that bind to IgM monoclonal autoantibodies (M-proteins) from two patients with motor neuron disease.

    ID: 1803206

    Description: epitope description:beta-D-Galp-(1->3)-D-GlcpNAc host organism:Homo sapiens

    Publication: 2461959;

  37. beta-Lactam allergenic determinants: fine structural recognition of a cross-reacting determinant on benzylpenicillin and cephalothin.

    ID: 1803207

    Description: epitope description:cefoxitin host organism:Homo sapiens

    Publication: 12569987;

  38. Monoclonal IgMs with anti-Gal(beta 1-3) GalNAc activity in lower motor neuron disease; identification of glycoprotein antigens in neural tissue and cr...

    ID: 1803211

    Description: epitope description:beta-D-Galp-(1->3)-D-GlcpNAc host organism:Homo sapiens

    Publication: 2470785;

  39. Establishment of a mouse IgA nephropathy model with the MBP-20-peptide fusion protein.

    ID: 1803213

    Description: epitope description:NVGGDNVDIHSIVPVGQDPH antigen name:ABC transporter, substrate-binding protein, putative host organism:Mus musculus BALB/c

    Publication: 20730864;

  40. Identification of immunodominant linear B-cell epitopes within the major outer membrane protein of Chlamydia trachomatis.

    ID: 1803215

    Description: epitope description:VLKTDVNKE host organism:Mus musculus BALB/c

    Publication: 20923859;

  41. Identification of immunodominant linear B-cell epitopes within the major outer membrane protein of Chlamydia trachomatis.

    ID: 1803223

    Description: epitope description:TRLIDERAAH host organism:Mus musculus BALB/c

    Publication: 20923859;

  42. Identification of immunodominant linear B-cell epitopes within the major outer membrane protein of Chlamydia trachomatis.

    ID: 1803225

    Description: epitope description:TRLIDERAAH host organism:Mus musculus BALB/c

    Publication: 20923859;

  43. Two sequence dimorphisms of DPB1 define the immunodominant serologic epitopes of HLA-DP.

    ID: 1803340

    Description: epitope description:EAV antigen name:HLA class II histocompatibility antigen, DP beta 1 chain host organism:Homo sapiens

    Publication: 19635517;

  44. Two sequence dimorphisms of DPB1 define the immunodominant serologic epitopes of HLA-DP.

    ID: 1803363

    Description: epitope description:GPM antigen name:HLA class II histocompatibility antigen, DP beta 1 chain host organism:Homo sapiens

    Publication: 19635517;

  45. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1803393

    Description: epitope description:azetidin-2-one host organism:Homo sapiens

    Publication: 11746950;

  46. Monoclonal antibody to the C-terminus of beta-amyloid.

    ID: 1803419

    Description: epitope description:GGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:2G9

    Publication: 7865758;

  47. Monoclonal antibody to the C-terminus of beta-amyloid.

    ID: 1803421

    Description: epitope description:GGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:2G9

    Publication: 7865758;

  48. Naturally-occurring human serum antibodies to inner core lipopolysaccharide epitopes of Neisseria meningitidis protect against invasive meningococcal ...

    ID: 1803423

    Description: epitope description:D-Glcp-(1->3)-[alpha-D-GlcpNAc-(1->2)]-6-PEA-L-alpha-D-Hepp-(1->3)-L-alpha-D-Hepp-(1->5)-[alpha-Kdo-(2->4)]-alpha-Kdo antigen name...

    Publication: 18835574;

  49. Serial expression of the truncated fragments of the nucleocapsid protein of CCHFV and identification of the epitope region.

    ID: 1803428

    Description: epitope description:ALNGYLNKHKDEVDKASADSMITNLLKHIAKAQELYKNSS antigen name:Crimean-Congo hemorrhagic fever orthonairovirus protein host organism:Orycto...

    Publication: 20960283;

  50. Naturally-occurring human serum antibodies to inner core lipopolysaccharide epitopes of Neisseria meningitidis protect against invasive meningococcal ...

    ID: 1803451

    Description: epitope description:D-Glcp-(1->3)-[alpha-D-GlcpNAc-(1->2)]-6-PEA-L-alpha-D-Hepp-(1->3)-L-alpha-D-Hepp-(1->5)-[alpha-Kdo-(2->4)]-alpha-Kdo antigen name...

    Publication: 18835574;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston