Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277701

    Description: epitope description:VLPVKNCRN antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  2. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277703

    Description: epitope description:PVKNCRNIT antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  3. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277710

    Description: epitope description:ITKKDMQFN antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  4. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277711

    Description: epitope description:TKKDMQFND antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  5. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277718

    Description: epitope description:FNDTTAHIE antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  6. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277729

    Description: epitope description:PETYHVFVD antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  7. The application of epitope mapping in the development of a new serological test for Helicobacter pylori infection.

    ID: 1277732

    Description: epitope description:YHVFVDGKE antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 8690944;

  8. Coexistence of multiple PrPSc types in individuals with Creutzfeldt-Jakob disease.

    ID: 1277796

    Description: epitope description:YSNQNNF antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:POM5

    Publication: 16297838;

  9. Coexistence of multiple PrPSc types in individuals with Creutzfeldt-Jakob disease.

    ID: 1277798

    Description: epitope description:V121, G122, G123, L124, G125, G126, Y127, M128, L129, G130, S131, A132, M133, S134, Q218, K219, E220, S221 antigen name:Major prio...

    Publication: 16297838;

  10. Isolation and characterization of a neutralizing antibody specific to internalization domain of Clostridium botulinum neurotoxin type B.

    ID: 1277800

    Description: epitope description:APGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYS...

    Publication: 15225558;

  11. Isolation and characterization of a neutralizing antibody specific to internalization domain of Clostridium botulinum neurotoxin type B.

    ID: 1277802

    Description: epitope description:APGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYS...

    Publication: 15225558;

  12. Coexistence of multiple PrPSc types in individuals with Creutzfeldt-Jakob disease.

    ID: 1277806

    Description: epitope description:QPHGGSW antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:POM2, POM12

    Publication: 16297838;

  13. Immunisation with a synthetic prion protein-derived peptide prolongs survival times of mice orally exposed to the scrapie agent.

    ID: 1277823

    Description: epitope description:PMIHFGNDWEDRYYRENMYRYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus NMRI

    Publication: 14550926;

  14. Immunisation with a synthetic prion protein-derived peptide prolongs survival times of mice orally exposed to the scrapie agent.

    ID: 1277826

    Description: epitope description:MERVVEQMCVTQYQKESQAYYDGRRS antigen name:Major prion protein host organism:Mus musculus NMRI

    Publication: 14550926;

  15. Characterization of the antibody response to the receptor binding domain of botulinum neurotoxin serotypes A and E.

    ID: 1277837

    Description: epitope description:KNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFK...

    Publication: 16177380;

  16. Lack of anti-GOR antibody among subjects with GB virus C/hepatitis G virus RNA.

    ID: 1277839

    Description: epitope description:GRRGQKAKSNPNRPL antigen name:Exonuclease GOR host organism:Homo sapiens antibody name:HGV-positive patient sera

    Publication: 9598933;

  17. Characterization of the hepatitis C virus E2 epitope defined by the broadly neutralizing monoclonal antibody AP33.

    ID: 1277842

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:AP33

    Publication: 16496330;

  18. Characterization of the hepatitis C virus E2 epitope defined by the broadly neutralizing monoclonal antibody AP33.

    ID: 1277850

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:AP33

    Publication: 16496330;

  19. Characterization of the antibody response to the receptor binding domain of botulinum neurotoxin serotypes A and E.

    ID: 1277860

    Description: epitope description:KNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFK...

    Publication: 16177380;

  20. Establishment of a chicken monoclonal antibody panel against mammalian prion protein.

    ID: 1277862

    Description: epitope description:THNQWNKPSKPKTNFK antigen name:Major prion protein host organism:Gallus gallus H.B15 antibody name:phAb3-15, HUNN1, HUNN2, phAb3-7

    Publication: 15297752;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston