Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antibodies to a synthetic peptide from the preS 120-145 region of the hepatitis B virus envelope are virus neutralizing.

    ID: 1495190

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2421497;

  2. Conserved and nonconserved epitopes among Haemophilus influenzae type b pili.

    ID: 1495253

    Description: epitope description:ETSGKVTFFGKVV antigen name:HafA major pilin protein host organism:Oryctolagus cuniculus antibody name:R13

    Publication: 1694821;

  3. Deduced amino acid sequences of class 1 protein (PorA) from three strains of Neisseria meningitidis. Synthetic peptides define the epitopes responsibl...

    ID: 1495353

    Description: epitope description:TKDTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:MN5C11G, 62-D12

    Publication: 1693651;

  4. Analysis of human IgE epitope of Der f 2 with anti-Der f 2 mouse monoclonal antibodies.

    ID: 1495358

    Description: epitope description:D80, N82, H85, C84, C89 antigen name:Der f 2 host organism:Mus musculus BALB/c antibody name:mAb 15E11

    Publication: 10369420;

  5. Establishment of a monoclonal antibody recognizing an antigenic site common to Clostridium botulinum type B, C1, D, and E toxins and tetanus toxin.

    ID: 1495381

    Description: epitope description:PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASA...

    Publication: 2450068;

  6. Analysis of human IgE epitope of Der f 2 with anti-Der f 2 mouse monoclonal antibodies.

    ID: 1495460

    Description: epitope description:C84, F86, C89, P90 antigen name:Der f 2 host organism:Mus musculus BALB/c antibody name:mAb 18G8

    Publication: 10369420;

  7. Polymorphism of the major surface epitope of the CopB outer membrane protein of Moraxella catarrhalis.

    ID: 1495477

    Description: epitope description:NKYAGKGY antigen name:Outer membrane protein CopB host organism:Mus musculus antibody name:10F3

    Publication: 16872370;

  8. Cross-reactivity studies of an anti-Plasmodium vivax apical membrane antigen 1 monoclonal antibody: binding and structural characterisation.

    ID: 1495509

    Description: epitope description:K385, E386, C390, P391, C392, E393, P394, E395, N408, C409, V410 antigen name:Apical merozoite antigen 1 host organism:Mus musculu...

    Publication: 17229439;

  9. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495552

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  10. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495563

    Description: epitope description:SPAPERRGYSGYDVPDY antigen name:Other Homo sapiens (human) protein host organism:Mus musculus antibody name:17/9

    Publication: 17936360;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston