Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification by phage display of the linear continuous MRPr1 epitope in the multidrug resistance-associated protein (MRP1).

    ID: 1494842

    Description: epitope description:LYSLNWQDL host organism:Rattus norvegicus Wistar antibody name:MRPr1

    Publication: 12674507;

  2. Identification by phage display of the linear continuous MRPr1 epitope in the multidrug resistance-associated protein (MRP1).

    ID: 1494856

    Description: epitope description:AGLLELNGW host organism:Rattus norvegicus Wistar antibody name:MRPr1

    Publication: 12674507;

  3. Identification by phage display of the linear continuous MRPr1 epitope in the multidrug resistance-associated protein (MRP1).

    ID: 1494862

    Description: epitope description:LTLNMDSGQ host organism:Rattus norvegicus Wistar antibody name:MRPr1

    Publication: 12674507;

  4. Identification by phage display of the linear continuous MRPr1 epitope in the multidrug resistance-associated protein (MRP1).

    ID: 1494865

    Description: epitope description:LSLNHHNNW host organism:Rattus norvegicus Wistar antibody name:MRPr1

    Publication: 12674507;

  5. Epitope specificity of murine and human bactericidal antibodies against PorA P1.7,16 induced with experimental meningococcal group B vaccines.

    ID: 1494934

    Description: epitope description:SAYTPAYYTKDTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 9093834;

  6. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1494983

    Description: epitope description:TFASRGTSMDDE antigen name:Nucleoprotein host organism:Capra hircus antibody name:Immune sera

    Publication: 17374767;

  7. Identification by phage display of the linear continuous MRPr1 epitope in the multidrug resistance-associated protein (MRP1).

    ID: 1494985

    Description: epitope description:ISLNFENYV host organism:Rattus norvegicus Wistar antibody name:MRPr1

    Publication: 12674507;

  8. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1495000

    Description: epitope description:D125, R129, Y130, F131, T132, Y133, P136, N137, D138, E148, S144, Y145, F147, E148 antigen name:Nucleoprotein host organism:Mus mu...

    Publication: 17374767;

  9. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1495003

    Description: epitope description:GGITGSMSLASGKSLLHEVDKD antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8741079;

  10. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1495004

    Description: epitope description:D125, R129, Y130, F131, T132, Y133, N137, D138, Y145, F147 antigen name:Nucleoprotein host organism:Mus musculus antibody name:IVB...

    Publication: 17374767;

  11. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1495007

    Description: epitope description:D125, R129, Y130, F131, T132, Y133, N137, D138, Y145, F147 antigen name:Nucleoprotein host organism:Mus musculus antibody name:IVB...

    Publication: 17374767;

  12. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1495009

    Description: epitope description:LDLLFWEQGGLCKALQEQCRFP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8741079;

  13. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1495012

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8741079;

  14. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1495030

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8741079;

  15. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1495035

    Description: epitope description:G120, D125, F131, Y133, N137, D138, E148 antigen name:Nucleoprotein host organism:Mus musculus antibody name:IIH2

    Publication: 17374767;

  16. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1495036

    Description: epitope description:D125, R129, Y130, F131, T132, Y133, P136, N137, D138, E148, S144, Y145, F147, E148 antigen name:Nucleoprotein host organism:Mus mu...

    Publication: 17374767;

  17. Structural comparison and epitope analysis of outer-membrane protein PIA from strains of Neisseria gonorrhoeae with differing serovar specificities.

    ID: 1495044

    Description: epitope description:WRND antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Mus musculus BALB/c antibody name:SM103, SM102, SM100

    Publication: 7506294;

  18. Structural comparison and epitope analysis of outer-membrane protein PIA from strains of Neisseria gonorrhoeae with differing serovar specificities.

    ID: 1495047

    Description: epitope description:DAKLTWRND antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Mus musculus antibody name:6D9

    Publication: 7506294;

  19. Use of synthetic peptides to map antigenic sites of Bordetella pertussis toxin subunit S1.

    ID: 1495054

    Description: epitope description:DDPPATVYRYDSRPPED antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens

    Publication: 2450153;

  20. Monoclonal antibodies recognize a processing dependent epitope present in the mature CS protein of various plasmodial species.

    ID: 1495055

    Description: epitope description:DPPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:3D11

    Publication: 1279504;

  21. Use of synthetic peptides to map antigenic sites of Bordetella pertussis toxin subunit S1.

    ID: 1495061

    Description: epitope description:LEHRMQEAVEAERAGRGTGHFI antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens

    Publication: 2450153;

  22. Generation and characterization of single-chain antibody fragments specific against transmembrane envelope glycoprotein gp46 of maedi-visna virus.

    ID: 1495095

    Description: epitope description:QELDCWHYQHYCVTSTKS antigen name:envelope polyprotein host organism:Mus musculus antibody name:B12, C12

    Publication: 14656464;

  23. Immunochemical analysis of Pseudomonas aeruginosa exotoxin A. Analysis of the His426 determinant.

    ID: 1495139

    Description: epitope description:LLQAHRQLEER antigen name:Exotoxin A host organism:Mus musculus NMRI antibody name:TC-1

    Publication: 1705936;

  24. Immunochemical analysis of Pseudomonas aeruginosa exotoxin A. Analysis of the His426 determinant.

    ID: 1495140

    Description: epitope description:LLQAHRQLEER antigen name:Exotoxin A host organism:Mus musculus NMRI antibody name:TC-1

    Publication: 1705936;

  25. Characterization of conserved T- and B-cell epitopes in Plasmodium falciparum major merozoite surface protein 1.

    ID: 1495164

    Description: epitope description:VTHESYQELVKKLEALEDAV antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 10768960;

  26. Antibody responses to defined regions of the Bordetella pertussis virulence factor pertactin.

    ID: 1495165

    Description: epitope description:GGAVPGGAVPGGAVPGGFGPGGFGP antigen name:Pertactin autotransporter host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 17926203;

  27. Characterization of conserved T- and B-cell epitopes in Plasmodium falciparum major merozoite surface protein 1.

    ID: 1495166

    Description: epitope description:VTHESYQELVKKLEALEDAV antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 10768960;

  28. Antibody responses to defined regions of the Bordetella pertussis virulence factor pertactin.

    ID: 1495170

    Description: epitope description:GGAVPGGAVPGGFGPGGFGPGGFGPGGFGP antigen name:Pertactin autotransporter host organism:Oryctolagus cuniculus New Zealand White antibo...

    Publication: 17926203;

  29. Antibody responses to defined regions of the Bordetella pertussis virulence factor pertactin.

    ID: 1495182

    Description: epitope description:PQPGPQPPQPPQPQPEAPAPQPPAG antigen name:Pertactin autotransporter host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 17926203;

  30. Antibodies to a synthetic peptide from the preS 120-145 region of the hepatitis B virus envelope are virus neutralizing.

    ID: 1495188

    Description: epitope description:MGGWSSKPRKGMGTNLSVPNP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2421497;

  31. Antibodies to a synthetic peptide from the preS 120-145 region of the hepatitis B virus envelope are virus neutralizing.

    ID: 1495190

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2421497;

  32. Conserved and nonconserved epitopes among Haemophilus influenzae type b pili.

    ID: 1495253

    Description: epitope description:ETSGKVTFFGKVV antigen name:HafA major pilin protein host organism:Oryctolagus cuniculus antibody name:R13

    Publication: 1694821;

  33. Deduced amino acid sequences of class 1 protein (PorA) from three strains of Neisseria meningitidis. Synthetic peptides define the epitopes responsibl...

    ID: 1495353

    Description: epitope description:TKDTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:MN5C11G, 62-D12

    Publication: 1693651;

  34. Analysis of human IgE epitope of Der f 2 with anti-Der f 2 mouse monoclonal antibodies.

    ID: 1495358

    Description: epitope description:D80, N82, H85, C84, C89 antigen name:Der f 2 host organism:Mus musculus BALB/c antibody name:mAb 15E11

    Publication: 10369420;

  35. Establishment of a monoclonal antibody recognizing an antigenic site common to Clostridium botulinum type B, C1, D, and E toxins and tetanus toxin.

    ID: 1495381

    Description: epitope description:PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASA...

    Publication: 2450068;

  36. Analysis of human IgE epitope of Der f 2 with anti-Der f 2 mouse monoclonal antibodies.

    ID: 1495460

    Description: epitope description:C84, F86, C89, P90 antigen name:Der f 2 host organism:Mus musculus BALB/c antibody name:mAb 18G8

    Publication: 10369420;

  37. Polymorphism of the major surface epitope of the CopB outer membrane protein of Moraxella catarrhalis.

    ID: 1495477

    Description: epitope description:NKYAGKGY antigen name:Outer membrane protein CopB host organism:Mus musculus antibody name:10F3

    Publication: 16872370;

  38. Cross-reactivity studies of an anti-Plasmodium vivax apical membrane antigen 1 monoclonal antibody: binding and structural characterisation.

    ID: 1495509

    Description: epitope description:K385, E386, C390, P391, C392, E393, P394, E395, N408, C409, V410 antigen name:Apical merozoite antigen 1 host organism:Mus musculu...

    Publication: 17229439;

  39. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495552

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  40. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495563

    Description: epitope description:SPAPERRGYSGYDVPDY antigen name:Other Homo sapiens (human) protein host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  41. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495589

    Description: epitope description:DLPDYGDYGEDLFDY antigen name:Other Homo sapiens (human) protein host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  42. Structural characterization of immunodominant regions of streptokinase recognized by murine monoclonal antibodies.

    ID: 1495594

    Description: epitope description:MKNYLSFGMFALL antigen name:Streptokinase host organism:Mus musculus A/J antibody name:A2.5

    Publication: 8823613;

  43. Protection against experimental malaria associated with AMA-1 peptide analogue structures.

    ID: 1495736

    Description: epitope description:YSEMKRASLTTPVLMEKPWY host organism:Aotus nancymaae

    Publication: 12220641;

  44. Protection against experimental malaria associated with AMA-1 peptide analogue structures.

    ID: 1495737

    Description: epitope description:YSEMKRASLTTPVLMEKPWY host organism:Aotus nancymaae

    Publication: 12220641;

  45. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1495782

    Description: epitope description:TYQDFDEN antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  46. Promiscuous peptides on the nontypeable Haemophilus influenzae P6 outer membrane protein.

    ID: 1495819

    Description: epitope description:SVADLQQRYNTVYFG antigen name:Outer membrane protein P6 host organism:Homo sapiens

    Publication: 18379862;

  47. Promiscuous peptides on the nontypeable Haemophilus influenzae P6 outer membrane protein.

    ID: 1495822

    Description: epitope description:ITGEYVQILDAHAAY antigen name:Outer membrane protein P6 host organism:Homo sapiens

    Publication: 18379862;

  48. Promiscuous peptides on the nontypeable Haemophilus influenzae P6 outer membrane protein.

    ID: 1495825

    Description: epitope description:DERGTPEYNIALGQR antigen name:Outer membrane protein P6 host organism:Homo sapiens

    Publication: 18379862;

  49. Induction of hepatitis A virus-neutralizing antibody by a virus-specific synthetic peptide.

    ID: 1495833

    Description: epitope description:STEQNVPDPQVG antigen name:Genome polyprotein host organism:Cavia porcellus Hartley

    Publication: 2991600;

  50. A high proportion of anti-peptide antibodies recognize foot-and-mouth disease virus particles.

    ID: 1495836

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 2844657;

  51. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492642

    Description: epitope description:LLGACSFSSI antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  52. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492643

    Description: epitope description:LLGACSFSSI antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  53. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492644

    Description: epitope description:LGACSFSSIP antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  54. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492647

    Description: epitope description:GACSFSSIPN antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  55. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492652

    Description: epitope description:SFSSIPNGTY antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  56. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492661

    Description: epitope description:FSSIPNGTYR antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  57. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492662

    Description: epitope description:PNGTYRATYQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  58. Identification of a new neutralization antigenic site on poliovirus coat protein VP2.

    ID: 1492668

    Description: epitope description:TPDNNQTSPARR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6208380;

  59. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492678

    Description: epitope description:TYQDFDENGW antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  60. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492683

    Description: epitope description:DFDENGWKDF antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  61. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492686

    Description: epitope description:FDENGWKDFL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  62. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492692

    Description: epitope description:NGWKDFLEVT antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  63. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492695

    Description: epitope description:WKDFLEVTFD antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  64. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492697

    Description: epitope description:KDFLEVTFDG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  65. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492698

    Description: epitope description:KDFLEVTFDG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  66. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492703

    Description: epitope description:LEVTFDGGKM antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  67. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492707

    Description: epitope description:VTFDGGKMVQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  68. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492708

    Description: epitope description:TFDGGKMVQV antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  69. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492719

    Description: epitope description:FDGGKMVQVV antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  70. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492725

    Description: epitope description:QVVYDYQHKE antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  71. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492727

    Description: epitope description:VVYDYQHKEG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  72. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492729

    Description: epitope description:YDYQHKEGRF antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  73. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492734

    Description: epitope description:HKEGRFKSQD antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  74. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492739

    Description: epitope description:FKSQDADYHR antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  75. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492750

    Description: epitope description:DYQHKEGRFK antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  76. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492754

    Description: epitope description:QDADYHRVMY antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  77. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492767

    Description: epitope description:MVQVVYDYQH antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  78. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492769

    Description: epitope description:KMVQVVYDYQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  79. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492779

    Description: epitope description:LADALLEKGN antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  80. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492783

    Description: epitope description:DALLEKGNPE antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  81. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492789

    Description: epitope description:EKGNPEMVDV antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  82. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492790

    Description: epitope description:SGIGPEKAFR antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  83. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492792

    Description: epitope description:GIGPEKAFRE antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  84. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492793

    Description: epitope description:GIGPEKAFRE antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  85. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492796

    Description: epitope description:RELADALLEK antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  86. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492799

    Description: epitope description:ELADALLEKG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  87. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492800

    Description: epitope description:HRVMYASSGI antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  88. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492805

    Description: epitope description:VMYASSGIGP antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  89. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492809

    Description: epitope description:IGPEKAFREL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  90. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492813

    Description: epitope description:PEKAFRELAD antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  91. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492815

    Description: epitope description:EKAFRELADA antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  92. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492833

    Description: epitope description:ATVSSQSFRR antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  93. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492843

    Description: epitope description:SFRRLGAALL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  94. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492845

    Description: epitope description:FRRLGAALLQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  95. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492851

    Description: epitope description:GAALLQSARR antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  96. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492853

    Description: epitope description:VVTGATVSSQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  97. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492856

    Description: epitope description:TGATVSSQSF antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  98. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492859

    Description: epitope description:TVSSQSFRRL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  99. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492861

    Description: epitope description:SSQSFRRLGA antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  100. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492866

    Description: epitope description:AALLQSARRG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston