Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466281

Description: epitope description:SESTEDQAMEDIKQMEAESI antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466283

Description: epitope description:SESTEDQAMEDIKQMEAESI antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466292

Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466294

Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466299

Description: epitope description:YLGYLEQLLRLKKYKVPQLE antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466318

Description: epitope description:IGVNQELAYFYPELFRQFYQ antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466325

Description: epitope description:RQFYQLDAYPSGAWYYVPLG antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466328

Description: epitope description:YVPLGTQYTDAPSFSDIPNP antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466331

Description: epitope description:YVPLGTQYTDAPSFSDIPNP antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

ID: 1466336

Description: epitope description:DIPNPIGSENSEKTTMPLW antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

Characterization of rubella virus-specific antibody responses by using a new synthetic peptide-based enzyme-linked immunosorbent assay.

ID: 1466405

Description: epitope description:NQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus antibody name:12B2D, 12B3G, 13A4H, 21B9...

Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

ID: 1466514

Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(1-2...

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

ID: 1466517

Description: epitope description:YPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAAASRAP antigen name:Nucleoprotein host organism:Gallus gallus

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

ID: 1466521

Description: epitope description:DLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYRVDQV antigen name:Nucleoprotein host organism:Gallus gallus

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

ID: 1466523

Description: epitope description:DGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLH antigen name:Nucleoprotein host organism:Gallus gallus

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466539

Description: epitope description:FSKCGFPFSLLVDAPGYDPIWFL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466548

Description: epitope description:QHDVNFTQEVSRLNINLHFSKCG antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466549

Description: epitope description:PIWFLNTEPSQLPPTAPPLLPHS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

ID: 1466551

Description: epitope description:LALSADQALQPPCPNLVSYSSYH antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

ID: 1466553

Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(10-...