Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799739

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 15864881;

  2. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799744

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 15864881;

  3. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799746

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 15864881;

  4. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799748

    Description: epitope description:phenoxymethylpenicillin host organism:Homo sapiens

    Publication: 15864881;

  5. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799767

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 15864881;

  6. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799781

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 15864881;

  7. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799800

    Description: epitope description:cephalosporin host organism:Homo sapiens

    Publication: 15864881;

  8. Immunity in the connective tissue diseases. The humoral side of the coin.

    ID: 1799811

    Description: epitope description:FRVVSVL host organism:Homo sapiens

    Publication: 8774549;

  9. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802037

    Description: epitope description:K310, G328, T329, D330, P332, K361, E362, P364, E384, K385 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 anti...

    Publication: 20369024;

  10. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802039

    Description: epitope description:K310, G328, T329, D330, P332, K361, E362, P364, E384, K385 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 anti...

    Publication: 20369024;

  11. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802044

    Description: epitope description:E311, E370, S390 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E108

    Publication: 20369024;

  12. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802052

    Description: epitope description:E311, E370, S390 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E108

    Publication: 20369024;

  13. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802053

    Description: epitope description:E311, E370, S390 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E108

    Publication: 20369024;

  14. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802062

    Description: epitope description:Y299, V300, M301, K310, V324, G328, P332, K334, P356 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  15. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802067

    Description: epitope description:Y299, V300, M301, K310, V324, G328, P332, K334, P356 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  16. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802073

    Description: epitope description:Y299, V300, M301, K310, V324, G328, P332, K334, P356 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  17. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802075

    Description: epitope description:Y299, V300, M301, K310, V324, G328, P332, K334, P356 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  18. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802076

    Description: epitope description:Y299, V300, M301, K310, V324, G328, P332, K334, P356 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  19. Apoptotic cells with oxidation-specific epitopes are immunogenic and proinflammatory.

    ID: 1802080

    Description: epitope description:1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine(1+) host organism:Mus musculus Swiss Webster

    Publication: 15583011;

  20. Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.

    ID: 1802098

    Description: epitope description:DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Homo sapiens

    Publication: 19581601;

  21. Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.

    ID: 1802119

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Homo sapiens

    Publication: 19581601;

  22. Immunization with a peptide surrogate for double-stranded DNA (dsDNA) induces autoantibody production and renal immunoglobulin deposition.

    ID: 1802161

    Description: epitope description:DWEYSVWLSN host organism:Mus musculus BALB/c

    Publication: 9653081;

  23. Expression of the Epstein-Barr virus nuclear antigen-1 (EBNA-1) in the mouse can elicit the production of anti-dsDNA and anti-Sm antibodies.

    ID: 1802276

    Description: epitope description:PPPGMRPP antigen name:Small nuclear ribonucleoprotein-associated protein N host organism:Mus musculus BALB/c

    Publication: 15324931;

  24. Human natural anti-alpha-galactosyl IgG. II. The specific recognition of alpha (1----3)-linked galactose residues.

    ID: 1802284

    Description: epitope description:alpha-D-galactosyl group host organism:Homo sapiens

    Publication: 2410529;

  25. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802307

    Description: epitope description:QIYKAQAQTDRESLRNLR antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus antibo...

    Publication: 3081631;

  26. DP reactive antibody in a zero mismatch renal transplant pair.

    ID: 1802315

    Description: epitope description:DE antigen name:HLA class II histocompatibility antigen, DP beta 1 chain host organism:Homo sapiens

    Publication: 18191721;

  27. Fab antibodies capable of blocking T cells by competitive binding have the identical specificity but a higher affinity to the MHC-peptide-complex than...

    ID: 1802321

    Description: epitope description:RLQGISPKI antigen name:Protein SSX2 host organism:Homo sapiens antibody name:Fab-VIIIE1

    Publication: 19524620;

  28. Novel monoclonal antibody-based enzyme immunoassay for determining plasma levels of ADAMTS13 activity.

    ID: 1802328

    Description: epitope description:REQAPNLVY antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:116, 146, 229

    Publication: 16934083;

  29. Novel monoclonal antibody-based enzyme immunoassay for determining plasma levels of ADAMTS13 activity.

    ID: 1802338

    Description: epitope description:DREQAPNLVYM antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:73

    Publication: 16934083;

  30. Lack of cross-species transmission of porcine endogenous retrovirus in pig-to-baboon xenotransplantation with sustained depletion of anti-alphagal ant...

    ID: 1802342

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 15818319;

  31. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802463

    Description: epitope description:YGCDVGPDGRLLRGHDQYAY antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus anti...

    Publication: 3081631;

  32. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802466

    Description: epitope description:CVEWLRRYLENGKDKLERADPPKT antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus ...

    Publication: 3081631;

  33. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802474

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 11746950;

  34. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802475

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 11746950;

  35. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802479

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 11746950;

  36. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802508

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 11746950;

  37. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802510

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 11746950;

  38. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802520

    Description: epitope description:TAAQITQRKWEAAREAEQRR antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus anti...

    Publication: 3081631;

  39. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802535

    Description: epitope description:REAEQRR antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus antibody name:R1C...

    Publication: 3081631;

  40. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802539

    Description: epitope description:QIYKAQAQTDRESLRNLR antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus antibo...

    Publication: 3081631;

  41. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802542

    Description: epitope description:CVEWLRRYLENGKDKLERADPPKT antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus ...

    Publication: 3081631;

  42. Recognition of HLA class I molecules by antisera directed to synthetic peptides corresponding to different regions of the HLA-B7 heavy chain.

    ID: 1802543

    Description: epitope description:KWEAAREAEQRR antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus antibody nam...

    Publication: 3081631;

  43. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802552

    Description: epitope description:amoxicillanyl group host organism:Homo sapiens

    Publication: 11746950;

  44. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802561

    Description: epitope description:benzylpenicillanyl group host organism:Homo sapiens

    Publication: 11746950;

  45. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802563

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 11746950;

  46. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802576

    Description: epitope description:phenoxymethylpenicilloyl group host organism:Homo sapiens

    Publication: 11746950;

  47. Reactivity of neuroborreliosis patients (Lyme disease) to cardiolipin and gangliosides.

    ID: 1802578

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 8410057;

  48. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802580

    Description: epitope description:cephalexin host organism:Homo sapiens

    Publication: 11746950;

  49. Fine structural recognition specificities of IgE antibodies distinguishing amoxicilloyl and amoxicillanyl determinants in allergic subjects.

    ID: 1802585

    Description: epitope description:ampicillin host organism:Homo sapiens

    Publication: 11746950;

  50. Reactivity of neuroborreliosis patients (Lyme disease) to cardiolipin and gangliosides.

    ID: 1802597

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 8410057;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston