Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853691

    Description: epitope description:(2R)-2-[(1R)-1-hydroxy-17-{(1R,2R)-2-[(2R,21R,22R)-21-hydroxy-22-methyltetracontan-2-yl]cyclopropyl}heptadecyl]hexacosanoic acid h...

    Publication: 20875402;

  2. Myosin-cross-reactive epitope of Shigella flexneri invasion plasmid antigen B.

    ID: 1853700

    Description: epitope description:LTNKITAWKSQQ antigen name:Invasin IpaB host organism:Mus musculus BALB/c antibody name:2F1

    Publication: 1370431;

  3. Unusual water-mediated antigenic recognition of the proinflammatory cytokine interleukin-18.

    ID: 1853705

    Description: epitope description:L51, P93, R140, P143, G144, H145, K148, E152, E157, F160, K176, E177, D178, E179, L180, G181, D182, R183, M186 antigen name:Interl...

    Publication: 19553661;

  4. Unusual water-mediated antigenic recognition of the proinflammatory cytokine interleukin-18.

    ID: 1853706

    Description: epitope description:L51, P93, R140, P143, G144, H145, K148, E152, E157, F160, K176, E177, D178, E179, L180, G181, D182, R183, M186 antigen name:Interl...

    Publication: 19553661;

  5. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1853708

    Description: epitope description:LLEQIKIPSWDRNNIPDENEQVIEDPQEDNKDEDEDEETETENLETEDDNNEE antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  6. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1853710

    Description: epitope description:LLEQIKIPSWDRNNIPDENEQVIEDPQEDNKDEDEDEETETENLETEDDNNEE antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  7. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1853713

    Description: epitope description:NLISNKNKKNDETKKTAENIVKTLVGLFNEKNEIDSTINNLVQEMIHLFSNN antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  8. A peptide mimotope of type 8 pneumococcal capsular polysaccharide induces a protective immune response in mice.

    ID: 1853714

    Description: epitope description:FHLPYNHNWFAL host organism:Mus musculus BALB/c

    Publication: 15618169;

  9. Myosin-cross-reactive epitope of Shigella flexneri invasion plasmid antigen B.

    ID: 1853774

    Description: epitope description:LTNKITAWKSQQ antigen name:Invasin IpaB host organism:Mus musculus BALB/c antibody name:2F1

    Publication: 1370431;

  10. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853775

    Description: epitope description:SSKVYTPTGSLP host organism:Capra hircus

    Publication: 21781322;

  11. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853779

    Description: epitope description:FPGAAGSNRSPL host organism:Capra hircus

    Publication: 21781322;

  12. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853784

    Description: epitope description:TLSWGLGSIRTA host organism:Capra hircus

    Publication: 21781322;

  13. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853785

    Description: epitope description:AEYSMYSAHRPR host organism:Capra hircus

    Publication: 21781322;

  14. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853789

    Description: epitope description:ATEIIPIALSRP host organism:Capra hircus

    Publication: 21781322;

  15. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853794

    Description: epitope description:TKLSHKN host organism:Capra hircus

    Publication: 21781322;

  16. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853799

    Description: epitope description:YNRAMIG host organism:Capra hircus

    Publication: 21781322;

  17. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853801

    Description: epitope description:SGKFYPV host organism:Capra hircus

    Publication: 21781322;

  18. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853807

    Description: epitope description:SWNHWSY host organism:Capra hircus

    Publication: 21781322;

  19. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853811

    Description: epitope description:SWKHWSY host organism:Capra hircus

    Publication: 21781322;

  20. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853899

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  21. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853900

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  22. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853905

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  23. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853906

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  24. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853907

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  25. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853924

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  26. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853934

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  27. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853935

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  28. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853937

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  29. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853939

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  30. An epitope conserved in orthopoxvirus A13 envelope protein is the target of neutralizing and protective antibodies.

    ID: 1853965

    Description: epitope description:ISSLYNLVKSS antigen name:Virion membrane protein A13 host organism:Mus musculus BALB/c antibody name:11F7

    Publication: 21810533;

  31. An epitope conserved in orthopoxvirus A13 envelope protein is the target of neutralizing and protective antibodies.

    ID: 1853967

    Description: epitope description:ISSLYNLVKSS antigen name:Virion membrane protein A13 host organism:Mus musculus BALB/c antibody name:11F7

    Publication: 21810533;

  32. An epitope conserved in orthopoxvirus A13 envelope protein is the target of neutralizing and protective antibodies.

    ID: 1853970

    Description: epitope description:ISSLYNLVKSS antigen name:Virion membrane protein A13 host organism:Mus musculus BALB/c antibody name:11F7

    Publication: 21810533;

  33. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853993

    Description: epitope description:AAIEQSETIDPMKVP antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  34. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853996

    Description: epitope description:KGELAMRNIEARGLK antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  35. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853997

    Description: epitope description:ARGLKQMKRQGDANV antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  36. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853998

    Description: epitope description:GDANVKGEEGIVKAH antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  37. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1854002

    Description: epitope description:TTHVISDIQDFVVAL antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  38. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1854009

    Description: epitope description:MTKVLAPAFKRELEK antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  39. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1861903

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 21798894;

  40. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1861905

    Description: epitope description:KESTQKAIDGVTNKVNS antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 21798894;

  41. Serological specificity of phenolic glycolipid I from Mycobacterium leprae and use in serodiagnosis of leprosy.

    ID: 1861912

    Description: epitope description:4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-m...

    Publication: 6193065;

  42. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1861934

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  43. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862011

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  44. Antibody-mediated neutralization of cytomegalovirus: modulation of efficacy induced through the IgG constant region.

    ID: 1862013

    Description: epitope description:ANETIYNTTLKYGDVVGVNT antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:ITC88

    Publication: 11922941;

  45. Structure-antigenicity relationship of peptides from the pre-S2 region of the hepatitis B virus surface antigen.

    ID: 1862052

    Description: epitope description:MQWNSTTFHQALLDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus antibody name:H8

    Publication: 7531533;

  46. Structure-antigenicity relationship of peptides from the pre-S2 region of the hepatitis B virus surface antigen.

    ID: 1862054

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus antibody name:H8

    Publication: 7531533;

  47. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862057

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  48. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862059

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  49. A hypoallergenic cat vaccine based on Fel d 1-derived peptides fused to hepatitis B PreS.

    ID: 1862109

    Description: epitope description:MTTISSSKDCMGEAVQNTVEDLKLNTLGR antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens

    Publication: 21411130;

  50. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862343

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston