ID: 1499742
Description: epitope description:TVWRNRETLMEFEEPHATKQ antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;ID: 1499745
Description: epitope description:VLIELEPPFGDSYIVVGRGE antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;ID: 1499770
Description: epitope description:LNLPWSSAGSTVWRNRETLM antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;ID: 1499775
Description: epitope description:SSVASLNDLTPVGRLVTVNP antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;ID: 1499781
Description: epitope description:YTPVEEKQNGRMIVIVAKKY antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c
Publication: 9712755;ID: 1499785
Description: epitope description:FNCLGMSNRDFLEGVSGATW antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;ID: 1499800
Description: epitope description:QLPFIFDVACVNGDFLFSMPCFAEALMRAQ antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c
Publication: 9712755;Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein.
ID: 1499808
Description: epitope description:N27, Q31, T32, K33, D35, S58, A59, D60, A61, D62, K125, K127 antigen name:Protein L1 host organism:Mus musculus antibody name:7D11
Publication: 17688903;ID: 1499814
Description: epitope description:FNCLGMSNRDFLEGVSGATW antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;ID: 1499828
Description: epitope description:GEYGEVTVDCEPRSGIDTNA antigen name:Genome polyprotein host organism:Equus caballus
Publication: 18190253;