Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315155

    Description: epitope description:GCSFSIFLLALLSCLTIPAS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  2. Monoclonal antibody AP33 defines a broadly neutralizing epitope on the hepatitis C virus E2 envelope glycoprotein.

    ID: 1315170

    Description: epitope description:ETHVTGGNAGRTTAGLVG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:R645, R646, R1020

    Publication: 16103160;

  3. Monoclonal antibody AP33 defines a broadly neutralizing epitope on the hepatitis C virus E2 envelope glycoprotein.

    ID: 1315175

    Description: epitope description:NTGWLAGLFYQHKFNSSG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:R645, R646, R1020

    Publication: 16103160;

  4. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315185

    Description: epitope description:SIVYETADMIMHTPGCVPCV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  5. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315186

    Description: epitope description:MHTPGCVPCVREDNSSRCWV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  6. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315200

    Description: epitope description:CNIGGLGNNTLICPTDCFRK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  7. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315205

    Description: epitope description:SSGCPERMASCRPIDRFAQG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  8. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315210

    Description: epitope description:ASEVCGPVYCFTPSPVVVGT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  9. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315215

    Description: epitope description:HSEATYTKCGSGPWLTPRCI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  10. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315216

    Description: epitope description:SGPWLTPRCIVDYPYRLWHY antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  11. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315218

    Description: epitope description:PCTVNFTIFKVRMYVGGIEH antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  12. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315229

    Description: epitope description:QKIQLINTNGSWHINRTALN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  13. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315244

    Description: epitope description:LICPTDCFRKHSEATYTKCG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  14. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315246

    Description: epitope description:SGPWLTPRCIVDYPYRLWHY antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  15. Synthetic peptide immunogens elicit polyclonal and monoclonal antibodies specific for linear epitopes in the D motifs of Staphylococcus aureus fibrone...

    ID: 1315261

    Description: epitope description:QGGNIVDIDFDSVP antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10678920;

  16. An antibody raised against a conserved sequence of the prion protein recognizes pathological isoforms in human and animal prion diseases, including Cr...

    ID: 1315548

    Description: epitope description:SQWNKPSKPKTN antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-PrP 95-108

    Publication: 9626045;

  17. An antibody raised against a conserved sequence of the prion protein recognizes pathological isoforms in human and animal prion diseases, including Cr...

    ID: 1315561

    Description: epitope description:SQWNKPSKPKTN antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-PrP 95-108

    Publication: 9626045;

  18. Characterization of lethal factor binding and cell receptor binding domains of protective antigen of Bacillus anthracis using monoclonal antibodies.

    ID: 1315569

    Description: epitope description:IKLNAKMNILIRDKRFHYDRN antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:2D3PA, 2D5PA...

    Publication: 8868446;

  19. T-Cell-dependent antibody response to the dominant epitope of streptococcal polysaccharide, N-acetyl-glucosamine, is cross-reactive with cardiac myosi...

    ID: 1315570

    Description: epitope description:N-acetyl-D-galactosamine antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:10D4-A9, 2D6-B1, 16B2-A1, 14G...

    Publication: 10992488;

  20. Characterization of lethal factor binding and cell receptor binding domains of protective antigen of Bacillus anthracis using monoclonal antibodies.

    ID: 1315605

    Description: epitope description:DGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGI antigen name:Protective antigen host organism:Mus musculus BALB/c antibody nam...

    Publication: 8868446;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston