Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501476

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7693508;

  2. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501484

    Description: epitope description:LLVRMKRAELYCPRP antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  3. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501485

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  4. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501496

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  5. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501500

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  6. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501504

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  7. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501506

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  8. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501508

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  9. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501566

    Description: epitope description:TAGEGIVIYGVDTGIDIGHADFGGRAEWGTN antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  10. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501573

    Description: epitope description:QDASNSSPASAPNVCTIAASTNSDGSASFTNFGSVVDLY antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston