Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499611

    Description: epitope description:TKELADKLSNAEASRDK antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  2. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499613

    Description: epitope description:ASRDKAFAVSKDLADKL antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  3. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499617

    Description: epitope description:DKAFAVSKDLADKLAAK antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  4. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499620

    Description: epitope description:AEAEKLMENVGSLDRLV antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  5. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499624

    Description: epitope description:AQKLAEIDQLTADKAKA antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  6. Immunogenicity of polymerizable synthetic peptides derived from a vaccine candidate against schistosomiasis: the asparaginyl endopeptidase (Sm32).

    ID: 1499714

    Description: epitope description:RTLDQQYKEVKRETDLSHVQ antigen name:Hemoglobinase (C13 family) host organism:Mus musculus C57BL/6

    Publication: 12941479;

  7. Immunogenicity of polymerizable synthetic peptides derived from a vaccine candidate against schistosomiasis: the asparaginyl endopeptidase (Sm32).

    ID: 1499723

    Description: epitope description:FLKVLKGDKSAGGKVLKSGK antigen name:Hemoglobinase (C13 family) host organism:Mus musculus Swiss

    Publication: 12941479;

  8. Immunogenicity of polymerizable synthetic peptides derived from a vaccine candidate against schistosomiasis: the asparaginyl endopeptidase (Sm32).

    ID: 1499726

    Description: epitope description:DIAYNLMNPFLGKLFNDYNH antigen name:Hemoglobinase (C13 family) host organism:Mus musculus Swiss

    Publication: 12941479;

  9. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499734

    Description: epitope description:KAACPTMGEAHNDKRADPAF antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  10. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499736

    Description: epitope description:VCRQGVVDRGWGNGCGLFGK antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  11. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499742

    Description: epitope description:TVWRNRETLMEFEEPHATKQ antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  12. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499745

    Description: epitope description:VLIELEPPFGDSYIVVGRGE antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  13. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499770

    Description: epitope description:LNLPWSSAGSTVWRNRETLM antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  14. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499775

    Description: epitope description:SSVASLNDLTPVGRLVTVNP antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  15. A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.

    ID: 1499781

    Description: epitope description:YTPVEEKQNGRMIVIVAKKY antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 9712755;

  16. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499785

    Description: epitope description:FNCLGMSNRDFLEGVSGATW antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  17. A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.

    ID: 1499800

    Description: epitope description:QLPFIFDVACVNGDFLFSMPCFAEALMRAQ antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 9712755;

  18. Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein.

    ID: 1499808

    Description: epitope description:N27, Q31, T32, K33, D35, S58, A59, D60, A61, D62, K125, K127 antigen name:Protein L1 host organism:Mus musculus antibody name:7D11

    Publication: 17688903;

  19. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499814

    Description: epitope description:FNCLGMSNRDFLEGVSGATW antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  20. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499828

    Description: epitope description:GEYGEVTVDCEPRSGIDTNA antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  21. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499830

    Description: epitope description:GEYGEVTVDCEPRSGIDTNA antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  22. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499834

    Description: epitope description:WGNGCGLFGKGSIDTCAKFA antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  23. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499837

    Description: epitope description:TVWRNRETLMEFEEPHATKQ antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  24. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499839

    Description: epitope description:TVWRNRETLMEFEEPHATKQ antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  25. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499842

    Description: epitope description:SVIALGSQEGALHQALAGAI antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  26. Peptide mimics of the group B meningococcal capsule induce bactericidal and protective antibodies after immunization.

    ID: 1493371

    Description: epitope description:PPWDFDAGEGIH host organism:Mus musculus BALB/c

    Publication: 17371999;

  27. Protection against measles virus encephalitis by monoclonal antibodies binding to a cystine loop domain of the H protein mimicked by peptides which ar...

    ID: 1493373

    Description: epitope description:CFQQACKGKIQALCENPEWAPLKDNRIPS antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 8887481;

  28. The identification and characterization of a monoclonal antibody to the vaccinia virus E3 protein.

    ID: 1493378

    Description: epitope description:GKSKRDAKNNAAKLAVDKLL antigen name:Protein E3 host organism:Mus musculus BALB/c antibody name:3015B2

    Publication: 17583368;

  29. Protection against measles virus encephalitis by monoclonal antibodies binding to a cystine loop domain of the H protein mimicked by peptides which ar...

    ID: 1493382

    Description: epitope description:CFQQACKNKIQALCENPEWAPLKDHRIPS host organism:Homo sapiens antibody name:Human sera

    Publication: 8887481;

  30. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493517

    Description: epitope description:VYDYQHKE antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  31. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493529

    Description: epitope description:SQDADYHR antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  32. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493530

    Description: epitope description:AALLQSAR antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  33. The induction of neutralizing antibodies by synthetic peptides of the envelope protein of type D simian retrovirus-1 (SRV-1).

    ID: 1493611

    Description: epitope description:LTATMIRDKSPSSGDGNVPTILGNNQ antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c X A/J

    Publication: 1652065;

  34. Epitope mapping of the hemagglutinin molecule of a highly pathogenic H5N1 influenza virus by using monoclonal antibodies.

    ID: 1493663

    Description: epitope description:R156 antigen name:Hemagglutinin host organism:Mus musculus antibody name:m24 or 24B9

    Publication: 17881439;

  35. The protective immune response induced by B cell epitope of classical swine fever virus glycoprotein E2.

    ID: 1493668

    Description: epitope description:TAVSPTTLR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 16455143;

  36. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493737

    Description: epitope description:DLNF antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  37. Generation of monoclonal antibodies against human prion proteins in PrP0/0 mice.

    ID: 1493741

    Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mab 12F10

    Publication: 8972487;

  38. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493746

    Description: epitope description:DLNF antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  39. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493751

    Description: epitope description:LENIPSENQYFQ antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  40. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493754

    Description: epitope description:VDDQEVINKASNSN antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  41. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493756

    Description: epitope description:QREDPTEKGLDFKLYWTDSQNKKEVISSDN antigen name:Protective antigen host organism:Mus musculus Swiss Webster

    Publication: 18480236;

  42. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493764

    Description: epitope description:SLAGERTWAETMGLNTADTAR antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  43. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493766

    Description: epitope description:LNAQDDFSSTPITMNYNQFL antigen name:Protective antigen host organism:Mus musculus C57BL/6

    Publication: 18480236;

  44. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493768

    Description: epitope description:AITCGQVTSSLAPCI antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  45. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493778

    Description: epitope description:SIPNGTYR antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  46. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493783

    Description: epitope description:GTYRATYQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  47. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493785

    Description: epitope description:QDADYHRV antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  48. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493788

    Description: epitope description:VTSSLAPCIGYVRSG antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  49. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493789

    Description: epitope description:VTSSLAPCIGYVRSG antigen name:Other Malus domestica (apple tree) protein host organism:Homo sapiens

    Publication: 18036340;

  50. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493797

    Description: epitope description:RSGGAVPPACCNGIR antigen name:Other Malus domestica (apple tree) protein host organism:Homo sapiens

    Publication: 18036340;

  51. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501476

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7693508;

  52. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501484

    Description: epitope description:LLVRMKRAELYCPRP antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  53. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501485

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  54. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501496

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  55. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501500

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  56. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501504

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  57. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501506

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  58. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501508

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  59. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501566

    Description: epitope description:TAGEGIVIYGVDTGIDIGHADFGGRAEWGTN antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  60. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501573

    Description: epitope description:QDASNSSPASAPNVCTIAASTNSDGSASFTNFGSVVDLY antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  61. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501598

    Description: epitope description:RNAPSWGLS antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  62. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501599

    Description: epitope description:NAPSWGLSR antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  63. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501602

    Description: epitope description:SWGLSRISS antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  64. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501604

    Description: epitope description:GLSRISSKK antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  65. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501605

    Description: epitope description:LSRISSKKS antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  66. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501613

    Description: epitope description:SGATDYVYD antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  67. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501615

    Description: epitope description:ATDYVYDST antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  68. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1501619

    Description: epitope description:LTGNSTLSSGYATARAGADILWDVG antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  69. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1501620

    Description: epitope description:LTGNSTLSSGYATARAGADILWDVG antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  70. Protection of mice against lethal viral infection by synthetic peptides corresponding to B- and T-cell recognition sites of influenza A hemagglutinin.

    ID: 1501632

    Description: epitope description:ACKRGPGSGFFSRLN antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:anti-HA1 peptide 3 IgM

    Publication: 7483766;

  71. Variations in the ospB gene of Borrelia burgdorferi result in differences in monoclonal antibody reactivity and in production of escape variants.

    ID: 1501643

    Description: epitope description:TISADSKKTKDLVFL antigen name:Outer surface protein B host organism:Mus musculus BALB/c antibody name:CB2

    Publication: 7505260;

  72. Protection of mice against lethal viral infection by synthetic peptides corresponding to B- and T-cell recognition sites of influenza A hemagglutinin.

    ID: 1501644

    Description: epitope description:IEKTNEKFHQIEK antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:anti-HA2 peptide 11IgM

    Publication: 7483766;

  73. Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

    ID: 1501713

    Description: epitope description:GSDYEDRYYRENM antigen name:Major prion protein host organism:Mus musculus NMRI antibody name:1.5D7, 1.6F4

    Publication: 18657541;

  74. Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

    ID: 1501717

    Description: epitope description:DYEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:6H4

    Publication: 18657541;

  75. Use of synthetic peptides to represent surface-exposed epitopes defined by neutralizing dengue complex- and flavivirus group-reactive monoclonal antib...

    ID: 1501834

    Description: epitope description:KKGSSIGQM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3A8.1

    Publication: 18559931;

  76. Structure of the mite-transmitted Blackcurrant reversion nepovirus using electron cryo-microscopy.

    ID: 1501973

    Description: epitope description:STSASAPNES antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:Ab-STS

    Publication: 18556038;

  77. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501979

    Description: epitope description:NSQVIAGMD antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  78. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501981

    Description: epitope description:QVIAGMDWA antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  79. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501984

    Description: epitope description:AGMDWAVKD antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  80. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501990

    Description: epitope description:VKDSKSRGA antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  81. Two different methods result in the selection of peptides that induce a protective antibody response to Neisseria meningitidis serogroup C.

    ID: 1502166

    Description: epitope description:AQAFDYVPAWVV host organism:Mus musculus BALB/c antibody name:1E4

    Publication: 14871530;

  82. Two different methods result in the selection of peptides that induce a protective antibody response to Neisseria meningitidis serogroup C.

    ID: 1502181

    Description: epitope description:YHACPPWVGIHRCEL host organism:Mus musculus BALB/c antibody name:1E4

    Publication: 14871530;

  83. Two different methods result in the selection of peptides that induce a protective antibody response to Neisseria meningitidis serogroup C.

    ID: 1502184

    Description: epitope description:SVYALPDLSVPVWVR host organism:Mus musculus BALB/c antibody name:1E4

    Publication: 14871530;

  84. Two different methods result in the selection of peptides that induce a protective antibody response to Neisseria meningitidis serogroup C.

    ID: 1502185

    Description: epitope description:VHMIKPPWVGRLSSG host organism:Mus musculus BALB/c antibody name:1E4

    Publication: 14871530;

  85. Two different methods result in the selection of peptides that induce a protective antibody response to Neisseria meningitidis serogroup C.

    ID: 1502188

    Description: epitope description:GLFVPPFWGTTSGDL host organism:Mus musculus BALB/c antibody name:1E4

    Publication: 14871530;

  86. Sequence uniqueness and sequence variability as modulating factors of human anti-HCV humoral immune response.

    ID: 1502295

    Description: epitope description:SQAEAALENL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18256830;

  87. Sequence uniqueness and sequence variability as modulating factors of human anti-HCV humoral immune response.

    ID: 1502298

    Description: epitope description:HRMAWDMMM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18256830;

  88. Sequence uniqueness and sequence variability as modulating factors of human anti-HCV humoral immune response.

    ID: 1502302

    Description: epitope description:VYTFYGMWP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18256830;

  89. Sequence uniqueness and sequence variability as modulating factors of human anti-HCV humoral immune response.

    ID: 1502309

    Description: epitope description:AEAAGRRLAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18256830;

  90. Sequence uniqueness and sequence variability as modulating factors of human anti-HCV humoral immune response.

    ID: 1502312

    Description: epitope description:RPYCWHYPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18256830;

  91. Japanese encephalitis protein vaccine candidates expressing neutralizing epitope and M.T hsp70 induce virus-specific memory B cells and long-lasting a...

    ID: 1502516

    Description: epitope description:EMEPPFGDSYIVVGRGDKQINHHWHKA antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 18761388;

  92. Japanese encephalitis protein vaccine candidates expressing neutralizing epitope and M.T hsp70 induce virus-specific memory B cells and long-lasting a...

    ID: 1502517

    Description: epitope description:EMEPPFGDSYIVVGRGDKQINHHWHKA antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 18761388;

  93. Functional characterization of fingers subdomain-specific monoclonal antibodies inhibiting the hepatitis C virus RNA-dependent RNA polymerase.

    ID: 1502528

    Description: epitope description:TVKAKLLSVE antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6G5, 7F12, 8G6

    Publication: 18574240;

  94. Epitope mapping of human anti-adeno-associated virus type 2 neutralizing antibodies: implications for gene therapy and virus structure.

    ID: 1502554

    Description: epitope description:EGIRQWWKLKPGPPPPKPAE antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10644347;

  95. Epitope mapping of human anti-adeno-associated virus type 2 neutralizing antibodies: implications for gene therapy and virus structure.

    ID: 1502556

    Description: epitope description:NLGRAVFQAKKRVLEPLGLV antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10644347;

  96. IgE-binding epitopes of the American cockroach Per a 3 allergen.

    ID: 1502573

    Description: epitope description:IPKGKKGGQAY antigen name:Per a 3 host organism:Homo sapiens

    Publication: 14510715;

  97. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502574

    Description: epitope description:IRRA antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  98. The p1 protein of the yeast transposon Ty1 can be used for the construction of bi-functional virus-like particles.

    ID: 1502580

    Description: epitope description:GWVDHFADGYDEVIA antigen name:Asp f 2 host organism:Mus musculus BALB/c

    Publication: 12736532;

  99. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502610

    Description: epitope description:KVVQERADMGVEKWLLQKIGRGTQRRKADDGDNDALLQLERMMSSEELERSVIES antigen name:capsid VP2 host organism:Equus caballus

    Publication: 10725425;

  100. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502615

    Description: epitope description:NQTARDEIRRA antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston