Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469483

    Description: epitope description:DVVDGMNFNRGY antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  2. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469486

    Description: epitope description:SGIKDFLPVLQQ antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  3. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469540

    Description: epitope description:GDRRKAMFEDIA antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  4. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469544

    Description: epitope description:NEDEQIGARIVL antigen name:60 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7679373;

  5. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469545

    Description: epitope description:SAPLKQIAANAG antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  6. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469550

    Description: epitope description:GAIIFQQVMSRS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;

  7. Chlamydia trachomatis major outer membrane protein epitopes expressed as fusions with LamB in an attenuated aro A strain of Salmonella typhimurium; th...

    ID: 1469595

    Description: epitope description:SAETIFDVTTLDPLNPTIAGAGDV host organism:Mus musculus C3H/He antibody name:Mouse anti-B1+B2 sera

    Publication: 1720166;

  8. Identification and localization of a limited number of predominant conformation-independent antibody epitopes of Theiler's murine encephalomyelitus vi...

    ID: 1470406

    Description: epitope description:FYSTNPDTTVPIYGKTISTPSDYMCGEFSDLL antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse anti-TMEV a...

    Publication: 1371268;

  9. The amino terminus of human cytomegalovirus glycoprotein B contains epitopes that vary among strains.

    ID: 1470417

    Description: epitope description:ASTAAPPYTNEQAYQMLLAL antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:CH405-1, CH421-5

    Publication: 1378884;

  10. Induction of a protective immunity against Schistosoma mansoni with ovalbumin-coupled Sm37-5 coadsorbed with granulocyte-macrophage colony stimulating...

    ID: 1470467

    Description: epitope description:SGPLKGILEYTEDEVVSSDFVG antigen name:Glyceraldehyde-3-phosphate dehydrogenase host organism:Mus musculus CBA/J antibody name:mouse ...

    Publication: 10078602;

  11. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470585

    Description: epitope description:MSPQRDRINAFYKDN antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  12. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470588

    Description: epitope description:MSPQRDRINAFYKDN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 7694357;

  13. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470593

    Description: epitope description:FYKDNPHPKGSRIVI antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  14. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470595

    Description: epitope description:SRIVINREHLMIDRP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  15. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470599

    Description: epitope description:MIDRPYVLLAVLFVM antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  16. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470600

    Description: epitope description:MIDRPYVLLAVLFVM antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  17. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470609

    Description: epitope description:GLLAIAGIRLHRAAI antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;

  18. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470619

    Description: epitope description:TNSIEHQVKDVLTPL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus C57BL/6

    Publication: 7694357;

  19. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470621

    Description: epitope description:TNSIEHQVKDVLTPL antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens

    Publication: 7694357;

  20. Analysis of the neutralizing antibody response to the measles virus using synthetic peptides of the haemagglutinin protein.

    ID: 1470622

    Description: epitope description:TNSIEHQVKDVLTPL antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 7694357;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston