Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Japanese encephalitis protein vaccine candidates expressing neutralizing epitope and M.T hsp70 induce virus-specific memory B cells and long-lasting a...

    ID: 1502516

    Description: epitope description:EMEPPFGDSYIVVGRGDKQINHHWHKA antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 18761388;

  2. Japanese encephalitis protein vaccine candidates expressing neutralizing epitope and M.T hsp70 induce virus-specific memory B cells and long-lasting a...

    ID: 1502517

    Description: epitope description:EMEPPFGDSYIVVGRGDKQINHHWHKA antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 18761388;

  3. Functional characterization of fingers subdomain-specific monoclonal antibodies inhibiting the hepatitis C virus RNA-dependent RNA polymerase.

    ID: 1502528

    Description: epitope description:TVKAKLLSVE antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6G5, 7F12, 8G6

    Publication: 18574240;

  4. Epitope mapping of human anti-adeno-associated virus type 2 neutralizing antibodies: implications for gene therapy and virus structure.

    ID: 1502554

    Description: epitope description:EGIRQWWKLKPGPPPPKPAE antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10644347;

  5. Epitope mapping of human anti-adeno-associated virus type 2 neutralizing antibodies: implications for gene therapy and virus structure.

    ID: 1502556

    Description: epitope description:NLGRAVFQAKKRVLEPLGLV antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10644347;

  6. IgE-binding epitopes of the American cockroach Per a 3 allergen.

    ID: 1502573

    Description: epitope description:IPKGKKGGQAY antigen name:Per a 3 host organism:Homo sapiens

    Publication: 14510715;

  7. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502574

    Description: epitope description:IRRA antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  8. The p1 protein of the yeast transposon Ty1 can be used for the construction of bi-functional virus-like particles.

    ID: 1502580

    Description: epitope description:GWVDHFADGYDEVIA antigen name:Asp f 2 host organism:Mus musculus BALB/c

    Publication: 12736532;

  9. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502610

    Description: epitope description:KVVQERADMGVEKWLLQKIGRGTQRRKADDGDNDALLQLERMMSSEELERSVIES antigen name:capsid VP2 host organism:Equus caballus

    Publication: 10725425;

  10. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502615

    Description: epitope description:NQTARDEIRRA antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston