Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502620

    Description: epitope description:LILALYDFHGRDVDGFAQGTRTAAIVETVAR antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  2. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502621

    Description: epitope description:QGTRTAAIVETVARMFPDFRSEVSEKFGIDLAVSEE antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  3. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502622

    Description: epitope description:ETVARMFPDFRSEVSEKFGIDLAVSEESDELFVKKTMVSSFS antigen name:capsid VP2 host organism:Gallus gallus Leghorn

    Publication: 10725425;

  4. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502631

    Description: epitope description:RCDLYPDGNLWGMPCPTY host organism:Mus musculus antibody name:2F2

    Publication: 10725425;

  5. Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

    ID: 1502632

    Description: epitope description:NCNPLEKWCPTVEQTPWY host organism:Mus musculus antibody name:2F2

    Publication: 10725425;

  6. Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library.

    ID: 1502648

    Description: epitope description:NHNDFRPMYTWR host organism:Mus musculus BALB/c antibody name:mAb C001

    Publication: 18241959;

  7. Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library.

    ID: 1502649

    Description: epitope description:HYDFSIKETSLQ host organism:Mus musculus BALB/c antibody name:mAb C001

    Publication: 18241959;

  8. Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

    ID: 1502847

    Description: epitope description:MKHM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus C57BL/6 antibody name:3F4

    Publication: 18657541;

  9. Hydropathic complementarity determines interaction of epitope (869)HITDTNNK(876) in Manduca sexta Bt-R(1) receptor with loop 2 of domain II of Bacillu...

    ID: 1502912

    Description: epitope description:RRPFNIGINNQQ antigen name:Other Bacillus thuringiensis protein host organism:Homo sapiens antibody name:scFv73

    Publication: 12050155;

  10. Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

    ID: 1502917

    Description: epitope description:YQRESQAYYQRGA antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rb486

    Publication: 18657541;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston