Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312563

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P8

    Publication: 16272297;

  2. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312564

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P9

    Publication: 16272297;

  3. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312568

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-PrP

    Publication: 16272297;

  4. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312578

    Description: epitope description:NFVHDCVNITIKQHTVT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-PrP

    Publication: 16272297;

  5. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312593

    Description: epitope description:MCVTQYQKESQAYYDGRRSSS antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P12

    Publication: 16272297;

  6. An anthrax lethal factor-neutralizing monoclonal antibody protects rats before and after challenge with anthrax toxin.

    ID: 1312626

    Description: epitope description:DSLSEEEKELLNRIQVDS + NAc(D1) antigen name:Lethal factor host organism:Mus musculus BALB/c antibody name:5B13B1

    Publication: 16177329;

  7. Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.

    ID: 1312630

    Description: epitope description:QIVGGVYLL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:19D9D6

    Publication: 12574359;

  8. Cryptic epitopes in N-terminally truncated prion protein are exposed in the full-length molecule: dependence of conformation on pH.

    ID: 1312760

    Description: epitope description:TNMKHM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus antibody name:3F4

    Publication: 11391773;

  9. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1312987

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:18Ie

    Publication: 12163260;

  10. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313005

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa

    Publication: 12163260;

  11. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313023

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa, 2Ed, 9Dd, 9Gc, 11Gb, 18Hd, 18Ie

    Publication: 12163260;

  12. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313028

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa, 2Ed, 9Dd, 9Gc, 11Gb, 18Hd, 18Ie

    Publication: 12163260;

  13. Reactivity to B cell epitopes within hepatitis C virus core protein and hepatocellular carcinoma.

    ID: 1313070

    Description: epitope description:QKKNKRNTNRRPQDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7528637;

  14. Reactivity to B cell epitopes within hepatitis C virus core protein and hepatocellular carcinoma.

    ID: 1313072

    Description: epitope description:GGVYLLPRRGPRLGV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7528637;

  15. Neutralizing linear epitopes of B19 parvovirus cluster in the VP1 unique and VP1-VP2 junction regions.

    ID: 1313074

    Description: epitope description:MSKKSGKWWESDDKFAKAVY antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7684458;

  16. Neutralizing linear epitopes of B19 parvovirus cluster in the VP1 unique and VP1-VP2 junction regions.

    ID: 1313076

    Description: epitope description:AKAVYQQFVEFYEKVTGTDL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7684458;

  17. Identification of a variant A-specific neutralizing epitope on glycoprotein B (gB) of human herpesvirus-6 (HHV-6).

    ID: 1313199

    Description: epitope description:N347 antigen name:DNA replication helicase host organism:Mus musculus antibody name:87-y-13

    Publication: 8813034;

  18. Disruption of anthrax toxin binding with the use of human antibodies and competitive inhibitors.

    ID: 1313299

    Description: epitope description:ETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEA...

    Publication: 10338505;

  19. Immunization with plasmid DNA encoding hepatitis C virus envelope E2 antigenic domains induces antibodies whose immune reactivity is linked to the inj...

    ID: 1313312

    Description: epitope description:IQLINTDGSWHINRTALNCNASHNTGW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9261444;

  20. Immunization with plasmid DNA encoding hepatitis C virus envelope E2 antigenic domains induces antibodies whose immune reactivity is linked to the inj...

    ID: 1313313

    Description: epitope description:IQLINTDGSWHINRTALNCNASHNTGW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9261444;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston