Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503130

    Description: epitope description:TMVTPGEL antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:3C5, 4B4, 4C5

    Publication: 11458006;

  2. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503132

    Description: epitope description:SREQLVEA antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:2A4

    Publication: 11458006;

  3. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503138

    Description: epitope description:FQNLQNHRIVQ antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  4. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503141

    Description: epitope description:IEAKPNTLVL antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  5. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503144

    Description: epitope description:VIQQGQA antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  6. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503149

    Description: epitope description:RVAKISMPVNTPGQF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  7. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503153

    Description: epitope description:EIRRVLLEENAG antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  8. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503178

    Description: epitope description:LFEVKPDKKNPQLQD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  9. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503355

    Description: epitope description:MMMASKDATSSVDGASGAGQLVPEVNTSDPLAMDPVAGSSTAV host organism:Mus musculus BALB/c antibody name:3E7, 4E6, 4F7, 7D2, 13F9, 1G9, 3D10, 4...

    Publication: 11710959;

  10. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503359

    Description: epitope description:GTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQ antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody nam...

    Publication: 11710959;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston