Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313385

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  2. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313386

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  3. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313391

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  4. Rabies virus glycoprotein as a carrier for anthrax protective antigen.

    ID: 1313398

    Description: epitope description:FHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKIL...

    Publication: 16820183;

  5. Characterization of monoclonal antibodies that specifically recognize the palm subdomain of hepatitis C virus nonstructural protein 5B polymerase.

    ID: 1313611

    Description: epitope description:DSTVTENDIRVEESIYQCCDLAPEARQAIKSLTERLY antigen name:Genome polyprotein host organism:Mus musculus antibody name:16A9C

    Publication: 11325472;

  6. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313617

    Description: epitope description:PGAKQNVQLINTNGSWHLNSTALNCNDSLNTGWLAGLFYH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10203493;

  7. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313625

    Description: epitope description:ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Mus musculus antibody name:C100c

    Publication: 10203493;

  8. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313627

    Description: epitope description:SRRFAQALPVWARPDYNPPLVETWKKPDYEPPVVHG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 10203493;

  9. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313629

    Description: epitope description:KNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTS antigen name:Genome polyprotein host organism:Mus musculus antibody name:C22c

    Publication: 10203493;

  10. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316657

    Description: epitope description:RANDVLWLSLTAAEYDQSTYGSSTGPVYVS antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  11. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316659

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  12. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316660

    Description: epitope description:PVYVSDSVTLVNVATGAQAVARSLDWTKVT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  13. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316665

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  14. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316675

    Description: epitope description:HTFDDFCPECRPLGLQGCAFQSTVAELQRL antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  15. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316677

    Description: epitope description:RPLGLQGCAFQSTVAELQRLKMKVGKTREL antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  16. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316686

    Description: epitope description:RNRSPERCDLGDDLHLQ antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  17. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316688

    Description: epitope description:DEQEQQEEQEQQEEQEQ antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  18. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316695

    Description: epitope description:VLRTSPPHRPGVRMRRV antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  19. Modulation of proteinase-K resistant prion protein by prion peptide immunization.

    ID: 1316719

    Description: epitope description:ENMYRYPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 11477546;

  20. DNA-based selection and screening of peptide ligands.

    ID: 1316746

    Description: epitope description:KTRTHTNAT host organism:Homo sapiens antibody name:affinity-purified C17

    Publication: 9831038;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston