Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503369

    Description: epitope description:PVAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTISPNN antigen name:Capsid protein VP1 host organism:Mus musculus C57BL/6 antibody name:1B4, 1F6

    Publication: 11710959;

  2. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503569

    Description: epitope description:KITCFLTAAGYCNTE antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  3. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503571

    Description: epitope description:FLTAAGYCNTECTLK antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  4. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503572

    Description: epitope description:TAAGYCNTECTLKKG antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  5. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503574

    Description: epitope description:YCNTECTLKKGSSGY antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  6. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503576

    Description: epitope description:ECTLKKGSSGYCAWP antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  7. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503581

    Description: epitope description:YCAWPACYCYGLPDS antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  8. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503586

    Description: epitope description:GLPDSVKIWTSETNK antigen name:Toxin Ts4 host organism:Equus caballus antibody name:anti-TsNTxP

    Publication: 11922945;

  9. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503617

    Description: epitope description:SKGCKITCFLTAAGY antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-TsNTxP

    Publication: 11922945;

  10. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503622

    Description: epitope description:TAAGYCNTECTLKKG antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-TsNTxP

    Publication: 11922945;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston