Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317894

Description: epitope description:SIYQCC antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317897

Description: epitope description:QCCDLA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317913

Description: epitope description:TERLYI antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317916

Description: epitope description:LYIGGP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317920

Description: epitope description:GPLTNS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317921

Description: epitope description:PLTNSK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317925

Description: epitope description:SKGQNC antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

ID: 1317928

Description: epitope description:QNCGYR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314262

Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 29

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314263

Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Homo sapiens antibody name:anti-HEV (strain Turkmenistan)

Comparative characterization of antigenic epitopes in the immunodominant region of the protein encoded by open reading frame 3 in Burmese and Mexican ...

ID: 1314265

Description: epitope description:HSAPLG antigen name:Protein ORF3 host organism:Cavia porcellus antibody name:anti-peptide 28

Human recombinant antibodies specific for hepatitis C virus core and envelope E2 peptides from an immune phage display library.

ID: 1313778

Description: epitope description:SGHMAWDMMNWSPT antigen name:Genome polyprotein host organism:Homo sapiens

Recombinant subunit ORF2.1 antigen and induction of antibody against immunodominant epitopes in the hepatitis E virus capsid protein.

ID: 1313921

Description: epitope description:TMDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKVGKTREL antigen name:Capsid protein host organism:Rattus norvegicus

Syntheses of four peptides from the immunodominant region of hepatitis C viral pathogens using PS-TTEGDA support for the investigation of HCV infectio...

ID: 1313923

Description: epitope description:HTPGCVPCVREQNSSRCWVALTPTVA antigen name:Genome polyprotein host organism:Homo sapiens

Syntheses of four peptides from the immunodominant region of hepatitis C viral pathogens using PS-TTEGDA support for the investigation of HCV infectio...

ID: 1313926

Description: epitope description:RPSWGPTDPRRRSRNLGKVLDTLT antigen name:Genome polyprotein host organism:Homo sapiens

Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

ID: 1313941

Description: epitope description:MSTNPKPQIK antigen name:Genome polyprotein host organism:Pan troglodytes

Induction of hepatitis C virus E1 envelope protein-specific immune response can be enhanced by mutation of N-glycosylation sites.

ID: 1314151

Description: epitope description:YEVRNVSGMYHVTNDCSNSSIVYEAADMIMHTPGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Induction of hepatitis C virus E1 envelope protein-specific immune response can be enhanced by mutation of N-glycosylation sites.

ID: 1314153

Description: epitope description:ITGHRMAWDMMMNWSPTTAL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Analyses of Gerstmann-Straussler syndrome with 102Leu219Lys using monoclonal antibodies that specifically detect human prion protein with 219Glu.

ID: 1314181

Description: epitope description:E219 antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:#41, #71

Molecular basis for antibody cross-reactivity between the hepatitis C virus core protein and the host-derived GOR protein.

ID: 1314184

Description: epitope description:RGQKAKSNPNRPLPVPRN antigen name:Exonuclease GOR host organism:Homo sapiens antibody name:anti-HCV positive patient serum