Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460400

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Oryctolagus cuniculus

    Publication: 15479266;

  2. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460402

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  3. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460405

    Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  4. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460794

    Description: epitope description:KNESKYSNTFINNAYNMSIRRSM antigen name:Merozoite surface antigen 2 host organism:Mus musculus BALB/c

    Publication: 17548134;

  5. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460804

    Description: epitope description:KKICKMEKCSSVFNV antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 17548134;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston