Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Mimotope mapping as a complementary strategy to define allergen IgE-epitopes: peach Pru p 3 allergen as a model.

    ID: 1500043

    Description: epitope description:KSNDLGSAPLQH host organism:Homo sapiens

    Publication: 18242709;
  2. Mimotope mapping as a complementary strategy to define allergen IgE-epitopes: peach Pru p 3 allergen as a model.

    ID: 1500046

    Description: epitope description:HNTVPSLWYHNR host organism:Homo sapiens

    Publication: 18242709;
  3. Schistosoma mansoni 28-kDa glutathione S-transferase and immunity against parasite fecundity and egg viability. Role of the amino- and carboxyl-termin...

    ID: 1500065

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus ...

    Publication: 8423348;
  4. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500073

    Description: epitope description:PPAAGPPAAGPPAAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:EBV-positive serum

    Publication: 7595412;
  5. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500075

    Description: epitope description:PPAAGPRILAPLSAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:EBV-positive serum

    Publication: 7595412;
  6. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500077

    Description: epitope description:PHIVTPPSARPRIMAPPVVR antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:EBV-positive serum

    Publication: 7595412;
  7. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500084

    Description: epitope description:PPAAGPPAAGPPAAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:healthy human serum

    Publication: 7595412;
  8. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500086

    Description: epitope description:PPAAGPRILAPLSAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:healthy human serum

    Publication: 7595412;
  9. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500087

    Description: epitope description:PLSAGPPAAGPHIVTPPSAR antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:healthy human serum

    Publication: 7595412;
  10. An influenza A vaccine based on tetrameric ectodomain of matrix protein 2.

    ID: 1500094

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSS antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 18252707;

Displaying 10 of 1,510,353 results for " "